Recombinant Gossypium barbadense Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPCGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKDGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, producing oxygen (O2) and a proton gradient that drives ATP synthesis.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what role does it play in photosynthesis?

The psbB gene encodes the CP47 protein (also known as the CP47 chlorophyll apoprotein), which is a core component of the Photosystem II (PSII) complex. This protein binds chlorophyll molecules and helps catalyze the primary light-induced photochemical processes of PSII . CP47 has been hypothesized to be involved in binding the reaction center chlorophyll, though this role is not definitively established .

Methodological approach: To study the basic function of psbB, researchers typically employ genetic interruption studies. For example, introducing a kanamycin resistance gene into the psbB sequence results in loss of Photosystem II activity, confirming that intact CP47 is required for a functional PSII complex . Complementary approaches include spectroscopic analyses of purified PSII complexes to determine energy transfer routes from antenna chlorophylls to the reaction center.

How conserved is the psbB gene across different plant species?

The psbB gene shows significant conservation across plant species, though with notable variations. Based on comparative studies, there is approximately 68% homology at the DNA sequence level between cyanobacterial (Synechocystis 6803) and higher plant (spinach) psbB genes, while the predicted amino acid sequences show higher conservation at 76% homology .

This conservation pattern extends to cotton species, with Gossypium raimondii (a relative of G. barbadense) showing immunological cross-reactivity with antibodies raised against CP47 from other plant species . This suggests structural and functional conservation of critical domains despite evolutionary divergence.

Species ComparisonDNA Sequence HomologyProtein Sequence Homology
Synechocystis vs. Spinach68%76%
G. barbadense vs. A. thalianaNot specified in literatureCross-reactivity confirmed
G. raimondii vs. other plantsNot specified in literatureCross-reactivity confirmed

What is the predicted structure of the CP47 protein?

The CP47 protein has a characteristic membrane-spanning structure with multiple transmembrane domains. Hydropathy pattern analysis between Synechocystis and spinach CP47 reveals almost indistinguishable profiles, indicating the same general folding pattern in the thylakoid membrane across different species . The protein contains five pairs of histidine residues that are spaced by 13 or 14 amino acids and are located in hydrophobic regions; these histidine residues may be involved in chlorophyll binding .

Methodological approach: Structural predictions typically combine hydropathy analysis, sequence alignments, and where available, crystallographic data. Hydropathy plots can be generated using the Kyte-Doolittle algorithm with a window size of 19-21 amino acids to identify transmembrane regions.

What specific amino acid residues in CP47 are critical for chlorophyll binding?

The CP47 protein contains several histidine residues that are hypothesized to coordinate chlorophyll molecules. Specifically, five pairs of histidine residues spaced by 13-14 amino acids within hydrophobic regions of the protein are thought to be involved in chlorophyll binding . These histidine pairs create binding pockets that coordinate the central magnesium ions of chlorophyll molecules.

Methodological approach: Site-directed mutagenesis of these histidine residues, followed by spectroscopic analysis of chlorophyll binding efficiency and energy transfer, can determine their specific roles. Mutants can be characterized using circular dichroism spectroscopy, fluorescence emission spectroscopy, and time-resolved absorption measurements to assess changes in chlorophyll binding and function.

Histidine PairPosition in ProteinPredicted FunctionEffect When Mutated
His-X₁₃-HisTransmembrane helix 1Chlorophyll coordinationReduced chlorophyll binding
His-X₁₄-HisTransmembrane helix 3Chlorophyll coordinationAltered energy transfer
His-X₁₃-HisTransmembrane helix 5Chlorophyll coordinationPSII assembly defects
His-X₁₃-HisTransmembrane helix 6Chlorophyll coordinationReduced PSII function
His-X₁₄-HisC-terminal regionChlorophyll coordinationVariable effects

How does CP47 contribute to water-deficit stress responses in plants?

Water-deficit stress significantly impacts photosynthetic performance, with CP47 being a target of stress-induced damage. Under water-deficit conditions, reactive oxygen species (ROS) can degrade the D1 protein of photosystem II , which functionally interacts with CP47. Plants may exhibit differential expression of psbB under water stress as part of acclimation responses.

Methodological approach: Gene expression studies comparing drought-stressed and well-watered plants can reveal regulation patterns of psbB. Combined with physiological measurements (gas exchange, chlorophyll fluorescence), researchers can correlate psbB expression with photosynthetic function under stress. Time-course experiments are particularly valuable for tracking the dynamics of these responses.

What is the relationship between CP47 and other PSII subunits in the assembly of functional complexes?

CP47 serves as a core structural component of PSII and is essential for proper assembly and function of the complex. Interruption of the psbB gene results in complete loss of PSII activity , indicating that CP47 is indispensable for PSII function. The protein likely serves as a scaffold for the assembly of other PSII subunits and facilitates proper positioning of reaction center components.

Methodological approach: Blue-native PAGE of solubilized thylakoid membranes followed by western blotting with antibodies against various PSII subunits can reveal assembly intermediates in wild-type versus psbB mutants. Pulse-chase experiments with radiolabeled amino acids can track the sequence of protein incorporation during PSII assembly.

What are the best methods for isolating and purifying recombinant CP47 protein from Gossypium barbadense?

The isolation of recombinant CP47 requires careful consideration of its membrane-associated nature and chlorophyll-binding properties.

Methodological approach:

  • Gene cloning: Amplify the psbB coding sequence from G. barbadense genomic DNA or cDNA using high-fidelity PCR.

  • Expression system selection: Use either a prokaryotic system (E. coli) with membrane-targeting sequences or eukaryotic systems (yeast, insect cells) for better protein folding.

  • Protein extraction: Employ detergent-based extraction (n-dodecyl-β-D-maltoside or Triton X-100) to solubilize membrane proteins.

  • Purification strategy: Utilize affinity chromatography (His-tag or streptavidin-binding peptide tag) followed by size exclusion chromatography.

  • Validation: Confirm identity via mass spectrometry and functional integrity through chlorophyll binding assays and circular dichroism spectroscopy.

How can antibodies against CP47 be effectively used in research applications?

Antibodies against CP47 serve as valuable tools for protein detection, localization, and functional studies. Commercial antibodies (like those offered by PhytoAB) show cross-reactivity with CP47 from multiple plant species, including Gossypium raimondii .

Methodological approach:

  • Western blotting: Use 1:1000 to 1:5000 dilution of primary antibody to detect CP47 in plant extracts.

  • Immunolocalization: Apply antibodies to fixed tissue sections to visualize CP47 distribution in chloroplasts.

  • Co-immunoprecipitation: Identify protein-protein interactions by precipitating CP47 and associated proteins.

  • ELISA: Quantify CP47 levels in different tissues or under various environmental conditions.

  • Storage recommendations: Store lyophilized antibodies at -20°C and avoid repeated freeze-thaw cycles .

What techniques are most effective for studying CP47-chlorophyll interactions?

Understanding CP47-chlorophyll interactions requires specialized spectroscopic and biochemical approaches.

Methodological approach:

  • Absorption spectroscopy: Measure chlorophyll binding by comparing absorption spectra before and after reconstitution of recombinant CP47 with chlorophyll.

  • Fluorescence resonance energy transfer (FRET): Assess energy transfer between chlorophyll molecules by measuring fluorescence lifetimes in native versus mutated CP47.

  • Circular dichroism: Analyze changes in protein secondary structure upon chlorophyll binding.

  • Site-directed mutagenesis: Systematically alter the five pairs of histidine residues hypothesized to coordinate chlorophyll molecules .

  • Crystallography or cryo-EM: Determine high-resolution structures of CP47 with bound chlorophylls.

How should researchers interpret sequence homology data for psbB across species?

Interpreting sequence homology requires consideration of both DNA and protein conservation patterns, as well as functional domains.

Methodological approach:

  • Multiple sequence alignment: Align psbB sequences from diverse species using MUSCLE or CLUSTAL algorithms.

  • Identify conserved domains: Focus on regions showing high conservation, particularly transmembrane domains and histidine pairs.

  • Calculate evolutionary rates: Different selective pressures on functional domains can be revealed through Ka/Ks ratio analysis.

  • Construct phylogenetic trees: Use maximum likelihood or Bayesian methods to infer evolutionary relationships.

  • Comparative analysis: The 76% protein sequence homology between cyanobacterial and higher plant CP47 suggests functional constraints maintaining critical domains despite over a billion years of evolutionary divergence.

What approaches help resolve contradictory findings about CP47 function?

Contradictory findings about CP47 function may arise from differences in experimental systems, conditions, or interpretations.

Methodological approach:

  • Systematic literature review: Compile studies with contradictory results and analyze methodological differences.

  • Multi-system validation: Test hypotheses in different organisms (cyanobacteria, algae, higher plants) to distinguish universal versus species-specific mechanisms.

  • Combinatorial mutations: Create combinations of point mutations to test interaction effects that may explain seemingly contradictory single-mutation studies.

  • Structural context: Interpret findings in the context of available structural data on PSII.

  • Environmental variables: Consider how experimental growth conditions (light intensity, temperature, nutrient availability) might influence results.

How can transcriptomic data on psbB expression be integrated with physiological measurements?

Integrating transcriptomic and physiological data provides deeper insights into CP47 function under various conditions, such as water-deficit stress .

Methodological approach:

  • Time-course experiments: Measure both gene expression and physiological parameters (photosynthetic rate, chlorophyll fluorescence) at multiple time points.

  • Correlation analysis: Calculate Pearson or Spearman correlation coefficients between psbB expression and physiological parameters.

  • Principal component analysis: Reduce dimensionality of complex datasets to identify key variables driving responses.

  • Network analysis: Place psbB in the context of co-expressed genes to identify functional modules.

  • Validation experiments: Use transgenic approaches (overexpression, RNAi) to confirm causative relationships suggested by correlative data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.