Recombinant Gossypium barbadense Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression and Storage
The recombinant protein is produced in E. coli and purified to high purity. Key production parameters include:

ParameterDetailSource
Expression SystemE. coli
FormLyophilized powder
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for storage
Storage BufferTris/PBS-based buffer, pH 8.0, with 6% trehalose
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Functional Significance in Gossypium barbadense

Role in Photosynthesis
The native Q(B) protein in G. barbadense is integral to PSII, facilitating electron transfer from the quinone Q(A) to Q(B) during photosynthesis. Herbivore-induced stress (e.g., Helicoverpa armigera infestation) downregulates genes related to photosynthesis, including psbA, while upregulating defense pathways like jasmonic acid signaling .

Research Applications

  1. Herbivore-Induced Defense Mechanisms:

    • H. armigera feeding triggers a 88% upregulation of JA pathway genes but suppresses photosynthesis-related genes, including psbA, highlighting a trade-off between growth and defense .

    • Recombinant Q(B) protein studies could elucidate how PSII activity modulates stress responses.

  2. Hybrid Heterosis Studies:

    • In interspecific hybrids (G. hirsutum × G. barbadense), Psb-related genes (e.g., PSII components) are upregulated, contributing to early biomass heterosis .

Comparative Analysis with Other Organisms

Sequence Conservation
The G. barbadense Q(B) protein (A0ZZ15) shares structural homology with homologs in other species, such as Prorocentrum micans (Q9TM72), though functional studies in G. barbadense remain limited .

Challenges and Future Directions

  • Purification Limitations: Repeated freeze-thaw cycles compromise protein stability, necessitating optimized handling protocols .

  • Functional Validation: In vitro assays to confirm recombinant Q(B) protein activity in PSII complexes are warranted.

This recombinant protein serves as a valuable tool for studying PSII dynamics in G. barbadense, particularly in the context of abiotic stress and hybrid vigor. Further studies integrating biochemical assays with transcriptomic data will enhance our understanding of its functional roles.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Gossypium barbadense (Sea-island cotton) (Egyptian cotton)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRLG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNLPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein and what is its role in Gossypium barbadense?

Photosystem Q(B) protein, also known as Photosystem II protein D1 or the 32 kDa thylakoid membrane protein, is a critical component of the photosynthetic machinery in cotton plants. This protein is encoded by the psbA gene and functions as part of the electron transport chain in Photosystem II (PSII) . In Gossypium barbadense (Sea-island cotton or Egyptian cotton), this protein plays an essential role in photochemical efficiency and reactive oxygen species (ROS) metabolism . It forms part of the thylakoid membrane structure and contributes to the plant's ability to convert light energy into chemical energy through photosynthesis .

How does Photosystem Q(B) protein interact with other components of the photosynthetic machinery?

Photosystem Q(B) protein interacts with multiple components of the photosynthetic apparatus to facilitate electron transport. Research indicates that in cotton plants, this protein interacts specifically with PsbX, another subunit of the PSII protein complex . This interaction appears to be crucial for maintaining proper PSII function and regulating ROS metabolism .

Additionally, the protein works in concert with various redox-active components like glutathione reductase (GR). Studies have shown that chloroplast GR plays an important role in PSII function by interacting with PsbX in cotton plants . This interaction forms part of the regulatory mechanism that maintains photochemical efficiency and controls ROS accumulation, particularly under stress conditions .

What experimental methods are recommended for purifying recombinant Gossypium barbadense Photosystem Q(B) protein?

For purifying recombinant Photosystem Q(B) protein from Gossypium barbadense, researchers typically employ a multi-step approach:

  • Expression System Selection: E. coli expression systems are commonly used, though yeast systems may offer advantages for membrane proteins.

  • Protein Extraction:

    • For membrane proteins like Photosystem Q(B), use specialized extraction buffers containing detergents to solubilize the protein.

    • Based on protocols used for similar thylakoid membrane proteins, employ grinding in liquid nitrogen followed by buffer extraction .

    • Include protease inhibitors to prevent degradation during extraction.

  • Chromatography Purification:

    • Initial purification can be performed using ion exchange chromatography like Strong Cation Exchange (SCX), as demonstrated in studies of thylakoid membrane proteins .

    • Further purification using affinity chromatography with suitable tags (His-tag is common for recombinant proteins).

    • Consider High-Performance Liquid Chromatography (HPLC) for highest purity, using systems similar to the Agilent 1100 HPLC system with appropriate columns .

  • Analysis and Verification:

    • Verify purity using SDS-PAGE and Western blotting.

    • Confirm identity through mass spectrometry analysis such as nano-LC ESI QqTOF MS, which has been successfully employed for thylakoid membrane proteins .

When storing the purified protein, maintain it in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage to preserve activity .

How can researchers effectively study the interaction between Photosystem Q(B) protein and other proteins like PsbX?

To study protein-protein interactions involving Photosystem Q(B) protein:

  • Yeast Two-Hybrid (Y2H) Assays: Research has successfully employed Y2H to identify interactions between GhGR1 and GhPsbX in cotton plants . This approach can be adapted to study other potential interaction partners of Photosystem Q(B) protein.

  • Co-Immunoprecipitation (Co-IP):

    • Use antibodies specific to Photosystem Q(B) protein to pull down protein complexes.

    • Analyze co-precipitated proteins by mass spectrometry to identify interaction partners.

    • This approach was effectively used in studies examining organelle immunoprecipitation in Arabidopsis .

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express fusion proteins in plant systems to visualize interactions in vivo.

    • This technique allows for subcellular localization of the interaction.

  • Complementation Experiments:

    • Perform complementation tests in model organisms like tobacco and yeast, as demonstrated in studies of GhGR1 interaction with GhPsbX .

    • These experiments can confirm functional relevance of identified interactions.

  • Proteomics Analysis:

    • Use quantitative proteomics-based analysis to identify potential interaction networks.

    • TMlabeled peptides and off-line strong cation exchange chromatography have been successfully employed in cotton protein studies .

When designing interaction studies, consider the membrane-embedded nature of Photosystem Q(B) protein and use appropriate detergents and buffer conditions to maintain protein solubility and native conformation.

What are the best approaches for studying the role of Photosystem Q(B) protein in reactive oxygen species (ROS) metabolism?

To investigate the role of Photosystem Q(B) protein in ROS metabolism:

  • ROS Measurement Techniques:

    • Employ fluorescent probes like 2',7'-dichlorodihydrofluorescein diacetate (H2DCF-DA) to detect and quantify intracellular ROS.

    • Use nitroblue tetrazolium (NBT) staining for superoxide detection and 3,3'-diaminobenzidine (DAB) for hydrogen peroxide visualization in plant tissues.

    • Quantify H2O2 content using commercial kits or spectrophotometric methods as implemented in studies of cotton plants .

  • Gene Silencing Approaches:

    • Utilize virus-induced gene silencing (VIGS) technology to temporarily suppress Photosystem Q(B) protein expression.

    • This technique has been successfully employed for functional verification of genes in Gossypium barbadense .

    • Design specific primers for the psbA gene region encoding Photosystem Q(B) protein.

  • Overexpression Studies:

    • Create transgenic plants overexpressing the psbA gene to observe effects on ROS levels.

    • Studies with GhGR genes have shown that overexpression in Arabidopsis decreased ROS levels in anthers and leaves compared to wild-type plants .

  • Biochemical Analysis:

    • Measure activities of antioxidant enzymes like ascorbate peroxidase (APX) that work in concert with photosynthetic proteins to manage ROS.

    • Quantify levels of non-enzymatic antioxidants such as reduced glutathione (GSH) and ascorbate (AsA) .

  • Photochemical Efficiency Measurements:

    • Use chlorophyll fluorescence to assess PSII photochemical efficiency in relation to ROS accumulation.

    • This approach revealed that decreased GR activity led to increased ROS and decreased photochemical efficiency in cotton plants .

How does the function of Photosystem Q(B) protein differ between normal and stress conditions in Gossypium barbadense?

  • Oxidative Stress Response:

    • Research indicates that Photosystem Q(B) protein's interaction with antioxidant systems becomes critical under stress conditions.

    • In cytoplasmic male sterile (CMS) cotton lines, decreased activity of glutathione reductase correlates with increased ROS accumulation and decreased photochemical efficiency of PSII .

    • The protein's function shifts toward maintaining redox homeostasis when plants experience oxidative stress.

  • Temperature Stress Adaptation:

    • Studies examining cotton seedlings under cold stress (10°C/5°C) showed alterations in thylakoid membrane protein expression and function .

    • Quantitative proteomics approaches revealed temperature-dependent changes in membrane protein composition, likely including Photosystem Q(B) protein.

  • Methodological Approach for Comparative Studies:

    • Use controlled growth chambers to subject plants to defined stress conditions while maintaining appropriate controls .

    • Employ TMlabeled peptides and mass spectrometry to quantify protein expression changes under different conditions .

    • Measure photochemical parameters using chlorophyll fluorescence techniques to correlate with protein function.

    • Examine ROS accumulation in parallel with photosynthetic efficiency measurements to establish functional relationships.

  • Interaction Networks Under Stress:

    • Under stress conditions, the interaction between Photosystem Q(B) protein and PsbX appears particularly important for maintaining PSII function .

    • This interaction may represent a regulatory mechanism that helps plants adapt to changing environmental conditions.

What are the most effective genetic modification strategies for studying Photosystem Q(B) protein function in cotton?

For advanced genetic modification of Photosystem Q(B) protein in cotton:

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs targeting specific regions of the psbA gene.

    • Create point mutations to study structure-function relationships without completely eliminating protein expression.

    • Use tissue-specific or inducible promoters to control timing and location of gene editing effects.

  • RNAi and VIGS Approaches:

    • Virus-induced gene silencing has been successfully applied in Gossypium barbadense for functional verification of genes .

    • For Photosystem Q(B) protein studies, design constructs targeting unique regions of the psbA transcript.

    • The experimental workflow should include:

      • Subcloning the target gene into a pTRV2 vector

      • Transforming Agrobacterium with pTRV1 and pTRV2 constructs

      • Inoculating cotton plants that have not yet developed true leaves

      • Growing plants under controlled conditions (25°C, 16h/8h light/dark cycle)

      • Assessing phenotypes after approximately 2 weeks

      • Validating silencing efficiency using qRT-PCR

  • Heterologous Expression Systems:

    • Express cotton Photosystem Q(B) protein in model organisms like Arabidopsis or tobacco.

    • Use complementation experiments in tobacco and yeast to study protein function and interactions .

    • This approach allows for faster generation times and easier genetic manipulation.

  • Chimeric Protein Approaches:

    • Create fusion proteins combining domains from Photosystem Q(B) proteins of different cotton species.

    • This approach can help identify functional domains and species-specific adaptations.

  • Quantification Methods:

    • Use the 2^(-ΔΔCt) method for qRT-PCR analysis to quantify gene expression changes .

    • Standardize reactions using appropriate reference genes such as UBQ7, which has been validated for cotton studies .

How do variations in Photosystem Q(B) protein between different Gossypium species impact photosynthetic efficiency and stress tolerance?

Comparative analysis of Photosystem Q(B) protein across Gossypium species reveals important insights into evolutionary adaptations and functional significance:

  • Interspecies Sequence Variation Analysis:

    • Compare Photosystem Q(B) protein sequences from G. barbadense, G. hirsutum, G. raimondii, and G. arboreum.

    • Identify conserved domains that are likely essential for core functions versus variable regions that may confer species-specific adaptations.

    • Studies of other gene families in cotton (like PIN genes) have demonstrated species-specific distribution patterns across chromosomes that may apply to photosystem genes as well .

  • Functional Characterization Methodology:

    • Conduct comparative photochemical efficiency measurements across species under identical growth conditions.

    • Measure parameters such as:

      • Maximum quantum yield of PSII (Fv/Fm)

      • Effective quantum yield (ΦPSII)

      • Non-photochemical quenching (NPQ)

      • Electron transport rate (ETR)

    • Correlate differences in these parameters with sequence variations in Photosystem Q(B) protein.

  • Stress Response Comparison:

    • Research on ascorbate metabolism showed that G. barbadense cultivars differ in their tolerance to Verticillium dahliae, with resistant cultivars maintaining higher ascorbate levels and inducing APX gene expression more strongly .

    • Similar comparative approaches can be applied to study how Photosystem Q(B) protein variants contribute to stress tolerance differences between species.

    • Experimental design should include:

      • Controlled stress application to different Gossypium species

      • Measurement of ROS accumulation and photosynthetic parameters

      • Correlation of responses with Photosystem Q(B) protein sequence and expression levels

  • Expression Pattern Analysis:

    • Examine tissue-specific and developmental expression patterns of the psbA gene across different cotton species.

    • Use transcriptomic data to identify regulatory differences that may explain functional variations.

What is the relationship between Photosystem Q(B) protein function and cytoplasmic male sterility in cotton?

Research indicates a complex relationship between photosynthetic proteins, including Photosystem Q(B) protein, and cytoplasmic male sterility (CMS) in cotton:

  • Mechanistic Connection:

    • CMS line Jin A exhibits increased accumulation of reactive oxygen species (ROS) at key stages of microspore abortion compared to maintainer Jin B .

    • This coincides with downregulation of glutathione reductase (GR) genes and decreased GR activity .

    • Since GR interacts with PsbX, which is part of the PSII complex containing Photosystem Q(B) protein, there appears to be a functional connection between photosynthetic efficiency and male sterility .

  • Experimental Investigation Approach:

    • Compare Photosystem Q(B) protein expression and activity between CMS lines and their maintainer lines at different developmental stages.

    • Use chlorophyll fluorescence to measure photochemical efficiency of PSII.

    • Quantify ROS levels in anthers and correlate with Photosystem Q(B) protein function.

    • Investigate potential post-translational modifications of Photosystem Q(B) protein in CMS lines using proteomics approaches.

  • Methodological Considerations:

    • Timing is critical - studies must focus on the key stage of microspore abortion in CMS lines .

    • Both anther-specific and leaf analyses should be performed to distinguish between tissue-specific effects.

    • Gene expression analysis should be conducted using qRT-PCR with the 2^(-ΔΔCt) method for quantification .

  • Transgenic Approach:

    • Create transgenic plants with modified Photosystem Q(B) protein expression to determine if this can affect male fertility.

    • Examine whether overexpression of genes encoding interacting partners (such as GR genes) can rescue the CMS phenotype by improving photosynthetic efficiency and reducing ROS accumulation .

What are the optimal storage and handling conditions for maintaining the activity of recombinant Photosystem Q(B) protein?

For optimal maintenance of recombinant Photosystem Q(B) protein activity:

  • Storage Buffer Composition:

    • Store in a Tris-based buffer with 50% glycerol, optimized specifically for this protein .

    • The high glycerol concentration helps prevent protein denaturation during freeze-thaw cycles.

  • Temperature Conditions:

    • For short-term storage (up to one week), maintain working aliquots at 4°C .

    • For extended storage, keep at -20°C or preferably at -80°C for maximum stability .

  • Aliquoting Strategy:

    • Divide purified protein into small single-use aliquots to avoid repeated freeze-thaw cycles.

    • Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

  • Handling Recommendations:

    • When working with the protein, maintain samples on ice.

    • Consider adding reducing agents such as DTT or β-mercaptoethanol to prevent oxidation of cysteine residues.

    • For membrane proteins like Photosystem Q(B), include appropriate detergents at concentrations above their critical micelle concentration to maintain solubility.

  • Quality Control Measures:

    • Periodically verify protein integrity using SDS-PAGE.

    • Test functional activity using appropriate assays before using in critical experiments.

How can researchers effectively design experiments to study the role of Photosystem Q(B) protein in photosynthetic efficiency?

To design robust experiments investigating Photosystem Q(B) protein's role in photosynthesis:

  • Experimental Design Framework:

    • Use paired experimental and control groups with appropriate biological replicates (minimum n=3).

    • Implement randomized block experimental designs to control for environmental variations .

    • Include both wild-type controls and positive controls (known photosynthesis mutants) for comparison.

  • Gene Manipulation Approaches:

    • For silencing studies, use virus-induced gene silencing (VIGS) with pTRV vectors as demonstrated in cotton research .

    • For overexpression, consider both constitutive (35S) and tissue-specific promoters.

    • Create concentration gradients of expression to establish dose-response relationships.

  • Photosynthetic Parameter Measurements:

    • Measure chlorophyll fluorescence parameters (Fv/Fm, ΦPSII, NPQ) using PAM fluorometry.

    • Conduct gas exchange measurements to assess CO2 assimilation rates.

    • Perform these measurements under various light intensities to establish light response curves.

    • Include both optimal and stress conditions to understand protein function across environmental ranges.

  • Molecular Analysis Methods:

    • Quantify gene expression using qRT-PCR with the 2^(-ΔΔCt) method .

    • Use UBQ7 or other validated reference genes for normalization .

    • Standard qPCR reaction conditions: 40 cycles of 94°C for 30s, 94°C for 5s, and 60°C for 30s .

  • Protein-Protein Interaction Studies:

    • Implement complementation experiments in tobacco and yeast to study interactions with other PSII components .

    • Use co-immunoprecipitation followed by mass spectrometry to identify novel interaction partners .

What analytical techniques are most appropriate for characterizing post-translational modifications of Photosystem Q(B) protein?

For comprehensive characterization of post-translational modifications (PTMs) in Photosystem Q(B) protein:

  • Mass Spectrometry-Based Approaches:

    • Employ liquid chromatography-mass spectrometry (LC-MS/MS) using systems such as nano-LC ESI QqTOF MS .

    • For sample preparation, use off-line strong cation exchange chromatography to fractionate peptides .

    • TMlabeled peptides can be used for quantitative comparison between different conditions .

  • Enrichment Strategies for Specific PTMs:

    • For phosphorylation: Use titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC).

    • For oxidative modifications: Use biotin-switch techniques or specific antibodies against oxidized residues.

    • For glycosylation: Employ lectin affinity chromatography followed by mass spectrometry.

  • Site-Directed Mutagenesis Approach:

    • Identify potential PTM sites through bioinformatic prediction and mass spectrometry.

    • Create site-specific mutants (e.g., phospho-mimetic or phospho-null) to study functional impacts.

    • Express these variants in appropriate systems and assess photosynthetic parameters.

  • PTM-Specific Antibodies:

    • Develop or obtain antibodies specific to common PTMs (phosphorylation, acetylation, etc.).

    • Use these for western blotting and immunoprecipitation experiments.

    • Employ immunofluorescence microscopy to visualize PTM distribution in plant tissues.

  • Dynamic PTM Studies:

    • Implement pulse-chase experiments to study PTM turnover rates.

    • Compare PTM profiles under different environmental conditions (light/dark, stress/control).

    • Correlate changes in PTMs with alterations in photosynthetic efficiency and ROS accumulation.

What are the most promising areas for future research on Gossypium barbadense Photosystem Q(B) protein?

Future research on Photosystem Q(B) protein should focus on several promising directions:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.