Recombinant Gossypium hirsutum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
HMG1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
HMG1
Target Protein Sequence
METHRRSSTNSIRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRW REKIRSSTPLHVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVE SEVLLRNEDARHVPCGQALDRSIRSLQPPEPIVTAEKVFDEMPVTVMTEEDEEIIRSVVC GMTPSYSLESKLDDCKRAAAIRREALQRITGKSLSGLPLDGFDYESILGQCCEMPVGYEQ IPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLRDGMTRAPVVR FGTAKRAADLKLYLEDPENFETLACVFNRSSRFARLQSIKCAIAGKNLYLRFSCFTGDAM GMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIINGD VVTKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIATGQDPAQNVESS HCITMMEAVNGGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKESPGANSI LLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKVSS
Uniprot No.

Target Background

Function

This recombinant Gossypium hirsutum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) catalyzes mevalonate synthesis, a crucial precursor for all isoprenoid compounds in plants.

Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. Plastid membrane; Multi-pass membrane protein.

Q&A

What is 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) in Gossypium hirsutum?

3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) in Gossypium hirsutum (upland cotton) is an enzyme that catalyzes the first committed step in the mevalonic acid (MVA) pathway for isoprenoid biosynthesis. Similar to its counterparts in other plant species, cotton HMG1 catalyzes the NADPH-dependent reduction of 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) to mevalonate. Based on research in other plant species, HMG1 is likely to be part of a small gene family, with G. hirsutum potentially containing multiple HMGR homologues that may exhibit different expression patterns and play distinct roles in plant development and defense responses .

How does HMG1 function in the isoprenoid biosynthesis pathway in cotton?

HMG1 functions as a rate-limiting enzyme in the MVA pathway in cotton, controlling the flux of metabolites toward isoprenoid biosynthesis. The enzyme catalyzes the conversion of HMG-CoA to mevalonate, which is subsequently phosphorylated and decarboxylated to form isopentenyl diphosphate (IPP), the building block for various isoprenoids. In cotton, these isoprenoids contribute to the synthesis of sesquiterpenes, phytosterols, and other secondary metabolites that play roles in plant development and defense mechanisms. Similar to other plant systems, cotton HMG1 likely requires NADPH as a cofactor for its reductive activity, possibly supported by reductases such as cytochrome P450 reductases that facilitate electron transfer .

What is the genomic organization of HMG1 in Gossypium hirsutum?

While specific data about HMG1 genomic organization in G. hirsutum is not directly provided in the search results, insights can be drawn from similar enzyme systems in cotton. The G. hirsutum genome, being allotetraploid, likely contains multiple copies of HMG1 genes. Based on analysis techniques used for other cotton genes, HMG1 gene structure can be determined by comparing coding sequences with corresponding genomic sequences using tools like GSDS software. The gene structure would typically include exons, introns, and untranslated regions. Promoter analysis to identify cis-acting elements that regulate HMG1 expression can be performed using bioinformatics tools similar to those mentioned for other cotton genes .

How does HMG1 in Gossypium hirsutum compare to HMG homologues in other plants?

Based on comparative studies of plant HMGRs, Gossypium hirsutum HMG1 likely shares significant sequence homology with other plant HMGR enzymes, particularly those from other dicotyledonous species. In litchi, two HMGR homologues (LcHMG1 and LcHMG2) share approximately 70% sequence identity at the amino acid level despite exhibiting distinct expression patterns during fruit development . Similar divergence might exist between cotton HMG1 and other potential HMG isoforms. Phylogenetic analysis of the HMG1 sequence using methods similar to those employed for other gene families in cotton (such as the neighbor-joining method with MEGA software) would help position G. hirsutum HMG1 within the evolutionary context of plant HMGRs .

What are the typical expression patterns of HMG1 in cotton tissues?

While specific expression data for G. hirsutum HMG1 is not directly provided in the search results, insights can be drawn from expression patterns of HMG homologues in other plants and other enzyme systems in cotton. Based on studies in litchi, HMG1 homologues may show tissue-specific and developmental stage-specific expression patterns. LcHMG1 in litchi exhibits highest expression in early fruit development, correlating with cell division, while LcHMG2 is more highly expressed in late fruit development . In cotton, gene expression analysis for HMG1 would typically involve techniques like qRT-PCR, Northern blotting, or RNA-seq to examine expression across different tissues (leaves, roots, stems, fibers, developing ovules) and under various environmental conditions or developmental stages .

What are the optimal conditions for expressing recombinant Gossypium hirsutum HMG1?

For optimal expression of recombinant G. hirsutum HMG1, researchers should consider several experimental approaches based on successful expression of other cotton enzymes. The full-length coding sequence of HMG1 can be cloned into expression vectors suitable for either prokaryotic (E. coli) or eukaryotic (yeast or insect cell) expression systems. For bacterial expression, the pETDUET-1 vector system has been successfully used for cotton enzymes like cytochrome P450s and their reductases . Expression conditions should be optimized for temperature (typically 16-28°C), induction duration (4-24 hours), and IPTG concentration (0.1-1.0 mM). Addition of a purification tag (His, GST, or MBP) may enhance solubility and facilitate purification. For eukaryotic expression, vectors like pYES2 (yeast) or baculovirus expression systems (insect cells) may be more suitable if proper folding, post-translational modifications, or membrane association is required for activity.

What methodologies are most effective for purifying active recombinant Gossypium hirsutum HMG1?

Purification of active recombinant G. hirsutum HMG1 requires careful consideration of enzyme stability and activity requirements. Based on purification protocols used for other plant reductases, a multi-step purification strategy is recommended. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed under gentle conditions, with elution using an imidazole gradient (50-250 mM). Further purification can be achieved through ion exchange chromatography (typically using Q-Sepharose or SP-Sepharose depending on the protein's pI) followed by gel filtration to obtain homogeneous protein preparations. Throughout purification, inclusion of glycerol (10-20%), reducing agents (DTT or β-mercaptoethanol, 1-5 mM), and protease inhibitors is crucial to maintain enzyme stability. Activity should be monitored during purification using a spectrophotometric assay that measures NADPH oxidation at 340 nm in the presence of the substrate HMG-CoA .

How can enzyme kinetics assays be optimized for recombinant Gossypium hirsutum HMG1?

Optimization of enzyme kinetics assays for recombinant G. hirsutum HMG1 requires careful consideration of reaction conditions and detection methods. The standard assay should measure the NADPH-dependent reduction of HMG-CoA to mevalonate, optimally performed at pH 6.5-7.5 (typically in potassium phosphate or Tris-HCl buffer) and 30-37°C. Kinetic parameters (Km, kcat, and Vmax) can be determined by varying substrate (HMG-CoA) concentrations (typically 5-500 μM) while maintaining saturating NADPH levels (≥200 μM). The reaction progress can be monitored by spectrophotometric detection of NADPH oxidation at 340 nm or by utilizing coupled enzyme assays. For more sensitive detection of the mevalonate product, LC-MS/MS methods can be developed. Effects of potential inhibitors, activators, or allosteric regulators should be systematically investigated by including these compounds in the reaction mixture at varying concentrations .

What experimental approaches can be used to study the physiological function of HMG1 in cotton development?

To study the physiological function of HMG1 in cotton development, multiple complementary approaches should be employed:

  • Gene expression analysis: Quantitative RT-PCR, RNA-seq, or Northern blotting can be used to examine HMG1 expression patterns across different tissues, developmental stages, and in response to various stresses.

  • Genetic manipulation: RNAi or CRISPR-Cas9 technology can be used to downregulate or knockout HMG1 in cotton. Overexpression lines can also be created using vectors like pK2GW7 under constitutive (35S) or tissue-specific promoters. Gateway cloning technology has been successfully used for cotton gene functional studies .

  • Metabolomic analysis: Changes in isoprenoid profiles in HMG1-modified plants can be analyzed using GC-MS or LC-MS techniques to correlate gene function with metabolic outcomes.

  • Phenotypic analysis: Detailed characterization of growth parameters, fiber development, seed oil content, and stress responses in HMG1-modified plants would provide insights into the physiological roles of the enzyme.

  • Protein-protein interaction studies: Yeast two-hybrid, BiFC, or co-immunoprecipitation techniques can identify interaction partners of HMG1 in cotton, illuminating its regulatory networks .

How does HMG1 expression in cotton respond to biotic and abiotic stresses?

Based on patterns observed with other enzyme systems in cotton, HMG1 expression likely responds dynamically to various stresses. Experimental approaches to investigate these responses should include:

  • Stress treatments: Cotton plants or tissue cultures should be subjected to controlled stress conditions including drought, salt, temperature extremes, wounding, pathogen infection, and herbivore attack.

  • Expression analysis: Changes in HMG1 transcript levels can be monitored using qRT-PCR, with careful selection of reference genes that remain stable under stress conditions. RNA-seq provides a more comprehensive view of transcriptional reprogramming.

  • Promoter analysis: Identification of stress-responsive elements in the HMG1 promoter can be performed using bioinformatics tools, followed by experimental validation using promoter-reporter constructs.

  • Comparative analysis: Expression patterns of HMG1 should be compared with those of other MVA pathway genes and defense-related genes to understand coordinated responses. In cotton, genes like GhCPR2 show inducible expression patterns in response to wounding or elicitor treatments, while others like GhCPR1 are constitutively expressed .

What protein interaction partners of Gossypium hirsutum HMG1 have been identified, and how do they regulate its activity?

Identification of protein interaction partners for G. hirsutum HMG1 requires multiple complementary approaches:

  • Yeast two-hybrid (Y2H) screening: The coding sequence of HMG1 can be cloned into a bait vector (such as pGBKT7) and used to screen a cotton cDNA library cloned into a prey vector (such as pGADT7). This approach has been successfully used to identify protein interactions in cotton .

  • Co-immunoprecipitation (Co-IP): Anti-HMG1 antibodies or antibodies against an epitope tag fused to HMG1 can be used to pull down protein complexes from cotton extracts, followed by mass spectrometry identification of interacting partners.

  • Bimolecular Fluorescence Complementation (BiFC): The HMG1 coding sequence can be fused to a partial YFP fragment (in vectors like pxy104-cYFP), while potential interacting proteins are fused to complementary YFP fragments (in vectors like pxy106-nYFP). Reconstitution of YFP fluorescence in plant cells indicates protein interaction .

  • Luciferase Complementation Imaging (LCI): Similar to BiFC, this technique involves fusing HMG1 and potential interactors to luciferase fragments and monitoring reconstituted luciferase activity .

How can structural studies of Gossypium hirsutum HMG1 inform rational enzyme engineering?

Structural studies of G. hirsutum HMG1 provide critical insights for rational enzyme engineering efforts aimed at modifying enzyme properties for agricultural applications. Key methodological approaches include:

  • Homology modeling: In the absence of a crystal structure, a homology model of cotton HMG1 can be constructed based on existing HMGR structures from other organisms using software like SWISS-MODEL, Phyre2, or MODELLER. This model can reveal important structural features including the catalytic site, cofactor binding regions, and regulatory domains.

  • X-ray crystallography: For direct structural determination, purified recombinant HMG1 should be subjected to crystallization trials using sparse matrix screens at various protein concentrations (5-20 mg/mL) and with different additives (particularly substrates, cofactors, or inhibitors to stabilize the protein). Diffraction-quality crystals can be used to determine the structure at high resolution.

  • Site-directed mutagenesis: Based on structural information, targeted mutations can be introduced to investigate the roles of specific amino acids in catalysis, substrate binding, or regulation. Mutant enzymes should be characterized for kinetic parameters and compared with the wild-type enzyme.

  • Molecular dynamics simulations: These computational approaches can provide insights into enzyme flexibility, substrate binding pathways, and conformational changes during catalysis, informing rational design strategies.

What methods are most effective for analyzing the impact of HMG1 on isoprenoid metabolic flux in cotton?

Analysis of HMG1's impact on isoprenoid metabolic flux in cotton requires sophisticated analytical and experimental approaches:

  • Metabolic flux analysis: Stable isotope labeling (typically with 13C-labeled acetate or glucose) can be used to trace carbon flow through the MVA pathway. Analysis of isotopomer distributions in downstream metabolites by GC-MS or LC-MS/MS can quantify flux changes resulting from HMG1 manipulation.

  • Untargeted metabolomics: LC-MS/MS or GC-MS analysis of extracts from wild-type and HMG1-modified cotton tissues can identify global metabolic changes beyond the immediate isoprenoid pathway. Principal component analysis (PCA) and hierarchical clustering can identify patterns of metabolite changes .

  • Targeted analysis of isoprenoids: Quantitative analysis of specific isoprenoid compounds (terpenes, sterols, carotenoids) using HPLC, GC-MS, or LC-MS with authentic standards provides direct evidence of HMG1's impact on end products.

  • Enzyme activity assays: In vitro assays of HMG1 and other MVA pathway enzymes from cotton tissues can identify potential feedback regulation mechanisms or rate-limiting steps.

What expression vectors and systems are most suitable for producing recombinant Gossypium hirsutum HMG1?

For optimal production of recombinant G. hirsutum HMG1, several expression systems should be considered:

  • Bacterial expression systems:

    • pET vector series (particularly pETDUET-1) in E. coli BL21(DE3) or Rosetta strains has been successfully used for cotton enzymes

    • pMAL-c2X for expression as maltose-binding protein fusion to enhance solubility

    • pGEX vectors for GST-fusion proteins that may improve folding

  • Yeast expression systems:

    • pYES2 for expression in Saccharomyces cerevisiae under galactose-inducible promoter

    • Pichia pastoris expression systems for potentially higher yields of active enzyme

  • Plant expression systems:

    • Gateway-compatible vectors like pK2GW7 for overexpression in cotton via Agrobacterium-mediated transformation

    • Virus-based vectors for transient expression in model plants like Nicotiana benthamiana

  • Insect cell/baculovirus systems:

    • pFastBac vectors for expression in insect cell lines, particularly useful if membrane association or specific post-translational modifications are required

The choice should be guided by considerations of required yield, enzymatic activity, post-translational modifications, and downstream applications.

What statistical methods are appropriate for analyzing HMG1 expression data across different cotton tissues and developmental stages?

Proper statistical analysis of HMG1 expression data requires careful experimental design and appropriate statistical methods:

  • Experimental design considerations:

    • Minimum of 3-4 biological replicates per condition

    • Inclusion of appropriate reference genes (e.g., GhUBQ7, GhPP2A1) for qRT-PCR normalization

    • Randomized sampling to minimize bias

  • Statistical methods for qRT-PCR data:

    • Normalization using multiple reference genes (using geNorm or NormFinder software)

    • Relative quantification using 2^(-ΔΔCt) or standard curve methods

    • Statistical significance testing using ANOVA followed by post-hoc tests (Tukey's HSD or Bonferroni correction) for multiple comparisons

    • Non-parametric tests (Kruskal-Wallis, Mann-Whitney) if normality assumptions are violated

  • Analysis of RNA-seq data:

    • Normalization methods including FPKM, TPM, or DESeq2 normalization

    • Differential expression analysis using packages like DESeq2, edgeR, or limma

    • Multiple testing correction using Benjamini-Hochberg procedure

    • Gene set enrichment analysis to identify coordinated expression changes in metabolic pathways

  • Multivariate analysis methods:

    • Principal Component Analysis (PCA) or t-SNE for visualizing global expression patterns

    • Hierarchical clustering to identify co-expressed genes

    • Time-series analysis for developmental expression patterns

These approaches ensure robust interpretation of expression data and minimize false discoveries in analysis of HMG1 regulation.

How might CRISPR-Cas9 gene editing be optimized for studying HMG1 function in Gossypium hirsutum?

Optimization of CRISPR-Cas9 gene editing for studying HMG1 function in G. hirsutum requires careful consideration of several factors:

  • sgRNA design considerations:

    • Target multiple sites within the HMG1 coding sequence to ensure successful knockout

    • Account for the tetraploid nature of G. hirsutum by designing sgRNAs that target conserved regions of all homoeologous copies

    • Use cotton-specific sgRNA design tools to minimize off-target effects

    • Include appropriate U6 or U3 promoters that function efficiently in cotton

  • Delivery methods:

    • Agrobacterium-mediated transformation of cotton hypocotyls using strains like GV3101 has been successful for cotton transformation

    • Particle bombardment as an alternative delivery method for recalcitrant cotton varieties

    • Protoplast transformation for transient assays to validate sgRNA efficiency

  • Screening strategies:

    • PCR-based genotyping followed by sequencing to identify mutations

    • T7 endonuclease I or surveyor nuclease assays for rapid mutation detection

    • RNA-seq to confirm reduction in HMG1 transcript levels

    • Enzyme activity assays to verify functional knockout

  • Advanced modifications:

    • Prime editing or base editing for precise sequence modifications in HMG1

    • Multiplex editing to target multiple members of the HMG family simultaneously

    • Integration of reporter genes for visualizing expression patterns

What approaches can be used to investigate the regulatory mechanisms controlling HMG1 expression in cotton?

Investigation of regulatory mechanisms controlling HMG1 expression in cotton requires a multi-faceted approach:

  • Promoter analysis:

    • Isolation and sequencing of the HMG1 promoter region (typically 1.5-3 kb upstream of start codon)

    • In silico analysis using plant promoter databases to identify cis-regulatory elements

    • Generation of promoter deletion constructs fused to reporter genes (GUS, LUC) to identify minimal regulatory regions

    • Site-directed mutagenesis of specific regulatory elements to verify their functionality

  • Transcription factor identification:

    • Yeast one-hybrid screening to identify proteins binding to the HMG1 promoter

    • ChIP-seq analysis to identify transcription factors binding to the HMG1 promoter in vivo

    • EMSA (Electrophoretic Mobility Shift Assay) to confirm direct binding

  • Epigenetic regulation:

    • Bisulfite sequencing to analyze DNA methylation patterns in the HMG1 promoter

    • ChIP analysis to examine histone modifications associated with active or repressed HMG1 chromatin

    • Investigation of small RNA regulation using small RNA-seq

  • Post-transcriptional regulation:

    • Analysis of HMG1 mRNA stability and half-life

    • Identification of microRNAs potentially targeting HMG1 transcripts

    • Investigation of alternative splicing patterns

How can systems biology approaches integrate HMG1 function into cotton metabolic networks?

Systems biology approaches provide powerful frameworks for integrating HMG1 function into cotton metabolic networks:

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and HMG1-modified cotton

    • Use correlation network analysis to identify genes, proteins, and metabolites associated with HMG1 function

    • Develop Bayesian networks to infer causal relationships within the metabolic system

  • Metabolic modeling:

    • Develop constraint-based metabolic models (using COBRA toolbox or similar) incorporating cotton isoprenoid metabolism

    • Perform flux balance analysis to predict the impact of HMG1 modification on metabolic fluxes

    • Integrate enzyme kinetic data to develop more detailed kinetic models

  • Network analysis tools:

    • Pathway enrichment analysis to identify biological processes affected by HMG1 manipulation

    • Metabolite Set Enrichment Analysis (MSEA) to identify patterns in metabolomics data

    • Gene regulatory network inference to understand transcriptional control of the MVA pathway

  • Comparative systems analysis:

    • Cross-species comparison of isoprenoid metabolism regulation (e.g., cotton vs. Arabidopsis)

    • Integration of developmental data to understand temporal regulation of HMG1 networks

    • Meta-analysis across different stress conditions to identify common regulatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.