Recombinant Gossypium hirsutum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMG2)

Shipped with Ice Packs
In Stock

Description

Introduction to Gossypium hirsutum HMG2

3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase (HMGR) represents a crucial enzyme in the mevalonate pathway, which serves as the primary route for isoprenoid biosynthesis in many organisms including cotton. In Gossypium hirsutum, two distinct HMGR-encoding genes have been identified: hmg1 and hmg2 . These genes encode enzymes that catalyze the conversion of 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) to mevalonic acid, representing the first committed and rate-limiting step in isoprenoid biosynthesis .

The discovery and characterization of the hmg2 gene in cotton has revealed its specialized role in plant metabolism. HMG2 functions as the first rate-limiting enzyme in the gossypol synthesis pathway, making it central to the production of defensive compounds in cotton . The enzyme has garnered significant interest due to its unique structural features and specialized functions that differentiate it from other plant HMGR enzymes, including its paralog HMG1 from the same species .

Recombinant HMG2 protein refers to the enzyme produced using genetic engineering techniques, typically expressed in heterologous systems such as Escherichia coli, and often modified with tags (such as histidine tags) to facilitate purification . This recombinant form enables detailed biochemical and structural studies of the enzyme, providing valuable insights into its function and potential applications.

Functional Roles in Cotton Plants

The HMG2 enzyme plays several critical roles in cotton plant metabolism and development, with functions extending beyond basic isoprenoid biosynthesis. Research has elucidated several specialized roles for this enzyme in cotton physiology:

Sesquiterpenoid Biosynthesis

HMG2 serves as a key enzyme in the gossypol synthesis pathway, where it functions as the first rate-limiting enzyme . This role makes it essential for the production of sesquiterpenoids, which are important defensive compounds in cotton. By catalyzing the conversion of HMG-CoA to mevalonic acid, HMG2 provides the fundamental building blocks for all terpenoid compounds, with particular importance for sesquiterpenoid production in cotton .

Pigment Gland Morphogenesis

One of the most intriguing aspects of HMG2 function is its association with the development of specialized pigment glands in cotton. These structures are responsible for containing and sequestering defensive compounds like gossypol. The expression of hmg2 has been shown to coincide with the morphogenesis of these specialized terpenoid-containing structures in developing cotton embryos . This temporal correlation suggests that HMG2 may play a role beyond simple enzymatic activity, potentially influencing the developmental processes that lead to pigment gland formation .

Defense Response Mechanisms

The expression of hmg2 can be induced by external mechanical damage or pathogen invasion, indicating its role in plant defense mechanisms . This inducible expression pattern demonstrates how HMG2 contributes to the adaptive responses of cotton plants to biotic stresses, likely by increasing the production of defensive terpenoid compounds in response to environmental challenges .

Regulatory Functions

The unique structural features of HMG2, particularly the 42-amino acid insertion between domains, suggest potential regulatory functions beyond its catalytic activity. These features may enable interactions with other proteins or signaling molecules involved in coordinating developmental processes and metabolic responses in cotton plants .

Gene Expression and Regulation

The hmg2 gene exhibits distinctive expression patterns that provide further insights into its specialized functions in cotton plants. DNA blot analysis has revealed that hmg2 belongs to a small subfamily that likely includes homeologous loci in allotetraploid cotton (Gossypium hirsutum) . This genetic organization reflects the complex genome structure of cultivated cotton, which is an allotetraploid species formed by the hybridization of two diploid ancestors.

Ribonuclease protection assays have demonstrated that hmg2 is differentially expressed in a developmentally- and spatially-modulated manner during the morphogenesis of specialized terpenoid-containing pigment glands in embryos . This precise regulation of expression suggests the presence of specific transcriptional control mechanisms that coordinate HMG2 activity with developmental processes.

Particularly noteworthy is the observation that induced expression of hmg2 coincides with a possible commitment to sesquiterpenoid biosynthesis in developing embryos . This temporal correlation supports the specialized role of HMG2 in the production of these defensive compounds, although researchers note that other developmental processes requiring HMGR activity cannot be excluded .

The responsiveness of hmg2 expression to environmental stimuli, such as mechanical damage or pathogen invasion, indicates the presence of stress-responsive regulatory elements controlling its transcription . This inducible expression pattern is consistent with the role of HMG2 in defense responses and demonstrates how plants can modulate specialized metabolic pathways in response to environmental challenges.

Production and Recombinant Expression

Recombinant production of Gossypium hirsutum HMG2 provides an essential tool for studying this enzyme's properties and functions. The recombinant protein is typically expressed in E. coli with an N-terminal histidine tag to facilitate purification through affinity chromatography . The specifications of commercially available recombinant HMG2 are summarized in Table 2:

Comparative Analysis with Related Enzymes

HMG2 from Gossypium hirsutum exhibits several distinctive features when compared to other plant HMGR enzymes, including its paralog HMG1 from the same species. These differences reflect the evolutionary divergence and functional specialization of HMGR isoforms in plants.

The most striking distinction is the size of HMG2, which at 628 amino acids represents the largest plant HMGR enzyme described to date . This size difference is primarily attributed to the unique 42-amino acid insertion between domains and the N-terminal hydrophobic domain, which are not present in HMG1 or other plant HMGR enzymes .

The specific expression patterns of hmg1 and hmg2 provide further evidence of functional divergence between these paralogs. While both genes are expressed during cotton development, they show distinct spatial and temporal patterns, suggesting different roles in plant metabolism . The expression of hmg2 is particularly associated with pigment gland development and sesquiterpenoid biosynthesis, indicating its specialization for these processes .

The unique features of HMG2 suggest that this enzyme has evolved specific adaptations for its role in cotton metabolism, particularly in relation to the production of defensive compounds and the development of specialized structures for their storage. This evolutionary divergence exemplifies how gene duplication and subsequent functional specialization can lead to the diversification of metabolic pathways in plants.

Research Applications and Significance

Recombinant Gossypium hirsutum HMG2 has significant implications for various research fields and potential biotechnological applications:

Metabolic Engineering

Understanding the role of HMG2 in sesquiterpenoid biosynthesis opens possibilities for engineering plants with enhanced or modified terpenoid profiles . This could be valuable for improving plant defense mechanisms, producing specific high-value compounds, or modifying the content of potentially toxic compounds like gossypol in cotton products.

Crop Improvement

Insights into HMG2 function could inform breeding or genetic engineering approaches for cotton improvement. Manipulating HMG2 expression or activity could potentially lead to modifications in gossypol content, which is desirable for certain applications such as improving the nutritional value of cottonseed products while maintaining defensive properties in other plant tissues .

Fundamental Plant Biology

The study of HMG2 contributes to our broader understanding of specialized metabolism in plants and the molecular mechanisms underlying the biosynthesis of defense compounds . It also provides insights into the coordination between metabolic pathways and developmental processes, such as the formation of specialized structures like pigment glands.

Future Research Directions

Despite significant advances in our understanding of Gossypium hirsutum HMG2, several important questions remain and represent promising avenues for future research:

Regulatory Mechanisms

Further investigation of the transcriptional, post-transcriptional, and post-translational regulatory mechanisms controlling HMG2 expression and activity would enhance our understanding of how terpenoid biosynthesis is regulated in response to developmental and environmental cues .

Metabolic Engineering Applications

Exploring the potential of manipulating HMG2 expression or activity to modify terpenoid profiles in cotton or other plants could lead to valuable biotechnological applications, such as enhanced pest resistance or production of specific high-value compounds .

Role in Pigment Gland Development

Additional research into the molecular mechanisms linking HMG2 activity to pigment gland morphogenesis could reveal novel insights into the coordination of metabolic and developmental processes in plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-628
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
HMG2
Target Protein Sequence
MEASRRSAVKPVIVLKPSKRFPLVEDTPGKASDALPLPLYLTNAVFFTLFFTVVYFLLSR WREKIRASIPLHAVTFPEIVAIFAFVASLIYLLGFFGIDFVQSLIIRPSGDVWSGEDYEE ENEVLLHEEDARTVPCGQALDCSVPSLPHMARNVTAQRLFDEKPVRVATEEDARKVSCGQ AVDCSLHSLPPRPPIVTSQKLFHEKTVIVTTEEDEEIIKSVVAGTLPSYSLESKLGDCKR AAAIRREALQRLTGRSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLLNGREYS VPMATTEGCLVASTNRGCKAIHLSGGATSILLKDGMTRAPVVRFSTAKRAAELKFYLEDP ENFDTLAVVFNRSSRFGRLQSIKCAIAGKNLYLRFTCSTGDAMGMNMVSKGVQNVLDFLQ TDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIEGDVVRKVLKTSVESLVELN MLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHI SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKDVAGANSRMLATIVTGAVLAGELSL MSALAAGQLVKSHMKYNRSSKDMSNLSS
Uniprot No.

Target Background

Function
Catalyzes the synthesis of mevalonate. It is the specific precursor of all isoprenoid compounds present in plants.
Database Links
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein. Plastid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.