Recombinant Gossypium hirsutum ADP,ATP carrier protein 1, mitochondrial (ANT1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Gossypium hirsutum ANT1

Gossypium hirsutum ADP,ATP carrier protein 1, mitochondrial (ANT1) belongs to the mitochondrial carrier family of membrane transport proteins. It is specifically expressed in upland cotton (Gossypium hirsutum), one of the most economically important cotton species worldwide. The protein functions as an adenine nucleotide translocator, facilitating the exchange of ADP and ATP across the inner mitochondrial membrane . This transport mechanism is fundamental to cellular bioenergetics, as it allows ATP synthesized within the mitochondrial matrix to be exported to the cytoplasm for energy-requiring reactions, while simultaneously importing ADP into the mitochondria for phosphorylation .

The gene encoding this protein is designated as ANT1, though it may also be labeled as CANT1 or LOC107926278 in some databases . The protein is primarily characterized by its ability to bind and transport adenine nucleotides, with a specific affinity for both ADP and ATP molecules. As a transporter protein embedded in the inner mitochondrial membrane, ANT1 exhibits a dynamic structure that alternates between cytoplasmic-open and matrix-open conformational states to facilitate nucleotide exchange .

Primary Structure and Domains

The Gossypium hirsutum ANT1 protein shares the characteristic features of the mitochondrial carrier family, including a tripartite structure consisting of three homologous sequence repeats of approximately 100 amino acids each . This structural arrangement creates a pseudo-symmetrical protein with three similar domains that together form a transport channel through the center of the molecule .

Each domain typically comprises:

  • An odd-numbered transmembrane helix

  • A loop containing a short matrix helix parallel to the membrane

  • An even-numbered transmembrane helix

This structural organization facilitates the conformational changes required for the transport mechanism, allowing the protein to alternate between states that expose the substrate-binding site to either the cytoplasmic or matrix side of the mitochondrial membrane.

Expression Systems and Production Methods

Recombinant Gossypium hirsutum ANT1 can be produced using various expression systems, each offering different advantages for protein yield, post-translational modifications, and functional properties. The common expression hosts include:

Expression SystemAdvantagesApplications
Escherichia coliHigh yield, cost-effective, rapid productionStructural studies, antibody production
YeastEukaryotic post-translational modifications, proper foldingFunctional studies, structural analysis
BaculovirusHigher eukaryotic processing, high expression levelsComplex functional studies
Mammalian CellMost authentic post-translational modificationsHigh-fidelity functional analysis
Cell-Free ExpressionRapid production, avoids cellular toxicityQuick screening, structural studies

The recombinant protein is typically produced with a purity of greater than or equal to 85% as determined by SDS-PAGE analysis . This level of purity is suitable for most research applications, including structural studies, functional assays, and antibody production.

Physical and Biochemical Properties

The recombinant Gossypium hirsutum ANT1 exhibits several important physical and biochemical properties that influence its functionality:

  1. Membrane localization: As a mitochondrial carrier, the protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane.

  2. Nucleotide binding: The protein contains specific binding sites for adenine nucleotides (ADP and ATP).

  3. Conformational flexibility: The protein undergoes significant conformational changes during the transport cycle, alternating between cytoplasmic-open and matrix-open states.

  4. Inhibitor sensitivity: Like other ADP/ATP carriers, the protein may be sensitive to specific inhibitors that lock it in one conformational state, such as bongkrekic acid which stabilizes the matrix-open state .

Transport Mechanism

The transport mechanism of Gossypium hirsutum ANT1, like other mitochondrial ADP/ATP carriers, involves a unique alternating access model. Recent structural studies of mitochondrial ADP/ATP carriers have revealed that these proteins switch between conformational states through rotation of their three domains around a central substrate-binding site .

The transport cycle involves:

  1. Binding of substrate (ADP or ATP) at the substrate-binding site

  2. Conformational change from cytoplasmic-open to matrix-open state (or vice versa)

  3. Release of the substrate on the opposite side of the membrane

  4. Return to the original conformational state to begin a new cycle

This dynamic transport mechanism is essential for maintaining the energy balance within plant cells, particularly in metabolically active tissues with high energy demands.

Physiological Role in Cotton Plants

In Gossypium hirsutum, the ANT1 protein plays several critical physiological roles:

  1. Energy metabolism: Facilitating the export of ATP from mitochondria to power cellular processes and the import of ADP for ATP synthesis.

  2. Metabolic regulation: Contributing to the regulation of the ATP/ADP ratio, which influences numerous metabolic pathways.

  3. Development: Supporting the high energy demands during cotton fiber development and seed formation.

  4. Stress response: Potentially participating in energy-dependent stress response mechanisms in cotton plants.

The efficient functioning of ANT1 is particularly important in cotton plants due to their complex developmental processes, including the formation of cotton fibers, which requires significant metabolic energy.

Functional Studies and Assays

The recombinant protein enables various functional studies:

  1. Transport assays to measure ADP/ATP exchange kinetics

  2. Inhibitor binding studies to identify molecules that modulate transport activity

  3. Interaction studies to identify protein partners that regulate ANT1 function

  4. Mutagenesis experiments to understand structure-function relationships

Antibody Production and Immunological Applications

Recombinant Gossypium hirsutum ANT1 can be used as an antigen for antibody production. Indeed, polyclonal antibodies against this protein are commercially available and can be used for various applications:

  1. Western blot analysis for protein detection and quantification

  2. Enzyme-linked immunosorbent assay (ELISA) for sensitive protein detection

  3. Immunohistochemistry to study protein localization in tissues

  4. Immunoprecipitation to isolate protein complexes

These antibodies typically exhibit high specificity for the Gossypium hirsutum ANT1 protein and are purified using antigen-affinity methods to ensure high quality and specificity .

Evolutionary Conservation

Mitochondrial ADP/ATP carriers are highly conserved across eukaryotes, reflecting their essential role in cellular energy metabolism. The ANT1 protein from Gossypium hirsutum shares structural and functional similarities with counterparts from various species, including:

SpeciesProtein NameNotable Features
Solanum tuberosum (Potato)ADP,ATP carrier protein, mitochondrial (ANT1)Also known as AAC, similar transport function
Zea mays (Maize)ADP,ATP carrier protein 1, mitochondrial (ANT1)Also known as MANT1, ANT-G1, GRMZM5G837108
Arabidopsis thalianaADP,ATP carrier protein 1, mitochondrial (AAC1)Also known as ADP/ATP carrier 1
Chlamydomonas reinhardtiiADP,ATP carrier protein (ABT)Also referred to as ANT1, adenine nucleotide translocator

The conservation of structural and functional features across these diverse plant species underscores the fundamental importance of ADP/ATP transport in plant bioenergetics and cellular metabolism.

Plant-Specific Adaptations

While maintaining core functional properties, plant ANT1 proteins, including the Gossypium hirsutum variant, may exhibit specific adaptations related to:

  1. Regulation in response to light/dark cycles

  2. Integration with photosynthetic metabolism

  3. Response to plant-specific environmental stressors

  4. Developmental regulation during plant-specific processes like seed formation and fiber development

These adaptations likely reflect the unique bioenergetic challenges faced by plants as photosynthetic organisms with complex developmental programs.

Current Research and Future Directions

Research on Gossypium hirsutum ANT1 and related mitochondrial carriers continues to advance our understanding of plant bioenergetics and cellular metabolism. Current and future research directions include:

  1. Detailed structural studies to elucidate the conformational changes during transport

  2. Investigation of regulatory mechanisms that modulate ANT1 activity in response to metabolic demands

  3. Exploration of potential roles in stress response and adaptation

  4. Biotechnological applications, including potential genetic engineering to enhance energy efficiency in cotton plants

The continuing development of recombinant protein production methods and structural biology techniques promises to provide even deeper insights into the function and regulation of this essential mitochondrial carrier.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ANT1; ADP,ATP carrier protein 1, mitochondrial; ADP/ATP translocase 1; Adenine nucleotide translocator 1; ANT 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
77-386
Protein Length
Full Length of Mature Protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
ANT1
Target Protein Sequence
APAEKGFSSFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDC FKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRG FNISCVGIIVYRGLYFGMYDSLKPVLLTGSMQDSFFASFVLGWLITNGAALASYPIDTVR RRMMMTSGKAVKYKSSLDAFSQILKNEGGKSLFKGAGSNILRAIAGAGVLAGYDKLQLIV FGKKYGSGGA
Uniprot No.

Target Background

Function
This protein acts as an ADP:ATP antiporter, mediating the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It transitions between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating through the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

UniGene: Ghi.8970

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the ADP,ATP carrier protein 1 in Gossypium hirsutum and how does it function?

The ADP,ATP carrier protein 1 in Gossypium hirsutum (upland cotton) belongs to the mitochondrial carrier family (TC 2.A.29) and catalyzes the exchange of ADP and ATP across the inner mitochondrial membrane . This protein plays a crucial role in cellular energy metabolism by facilitating the export of ATP synthesized in the mitochondrial matrix to the cytosol, while simultaneously importing ADP for continued ATP synthesis.

Similar to its Arabidopsis thaliana ortholog, the cotton ANT1 protein likely contains approximately 380-390 amino acids and features the characteristic structure of mitochondrial carrier proteins with six transmembrane domains . The protein's primary function is maintaining the energy equilibrium required for various cellular processes, particularly under stress conditions.

How is ANT1 expression regulated in cotton under different environmental conditions?

ANT1 expression in cotton shows dynamic regulation patterns in response to environmental stressors. Based on research with related stress-response genes in cotton, ANT1 likely exhibits altered expression under salt stress conditions. Studies on other cotton genes indicate that stress-responsive elements in the promoter regions control transcriptional activation under adverse conditions .

The regulation mechanism may involve interactions with transcription factors such as MYC2, which has been shown to interact with JAZ proteins in cotton stress responses . For experimental validation of expression patterns, quantitative RT-PCR with gene-specific primers is the recommended approach, with normalization using reference genes such as cotton histone or ubiquitin.

What are the challenges in purifying functional recombinant ANT1 from cotton?

Purification of functional ANT1 from cotton presents several technical challenges:

  • Membrane protein solubilization: As a mitochondrial membrane protein, ANT1 requires careful selection of detergents that maintain protein structure while enabling extraction from the lipid bilayer. Typically, mild detergents like n-dodecyl β-D-maltoside (DDM) at 1-2% concentration yield better results than harsher detergents.

  • Expression system selection: Heterologous expression in E. coli often leads to inclusion body formation, requiring refolding protocols that may compromise function. Eukaryotic expression systems like yeast or insect cells generally provide better functional yields for plant mitochondrial proteins.

  • Functional assessment: Verifying transport activity requires reconstitution into liposomes and development of transport assays that can detect the ADP/ATP exchange activity using radioisotope-labeled nucleotides or fluorescent ATP analogs.

  • Protein stability: The protein often exhibits reduced stability outside its native lipid environment, necessitating optimization of buffer conditions including pH (typically 7.2-7.5), salt concentration (100-200 mM NaCl), and addition of stabilizing agents such as glycerol (10-15%).

What expression systems are most effective for producing recombinant cotton ANT1?

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)
E. coli- Cost-effective
- Rapid growth
- Simple genetic manipulation
- Inclusion body formation
- Lack of post-translational modifications
- Potential toxicity
0.5-2.0
Pichia pastoris- Higher yields
- Post-translational modifications
- Growth to high cell density
- Longer expression time
- More complex genetic manipulation
- Glycosylation patterns differ from plants
2.0-5.0
Insect cells- More native-like folding
- Post-translational modifications
- Good for membrane proteins
- Expensive
- Time-consuming
- Technical expertise required
1.0-4.0
Plant expression systems- Native post-translational modifications
- Natural folding environment
- Potential for field-scale production
- Lower yields
- Longer growth cycles
- More complex extraction
0.1-1.0

For functional studies, insect cell or yeast expression systems typically provide the best balance between yield and proper folding for mitochondrial carrier proteins like ANT1. For structural studies requiring isotope labeling, E. coli systems with optimization for membrane protein expression (such as C41/C43 strains or fusion tags) may be preferred despite lower functional yields.

What methodologies are most effective for studying ANT1 interaction with other proteins in the cotton mitochondrial membrane?

Several complementary approaches can effectively characterize ANT1 protein interactions:

  • Co-immunoprecipitation (Co-IP): Using ANT1-specific antibodies to pull down protein complexes from solubilized mitochondrial membranes, followed by mass spectrometry identification of interaction partners. This requires developing specific antibodies against cotton ANT1 or using epitope tags in recombinant systems.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing potential interacting proteins with complementary fragments of a fluorescent protein (like YFP), interactions can be visualized in planta. This approach is particularly useful for confirming interactions identified through other methods.

  • Yeast two-hybrid membrane system: Modified Y2H systems designed for membrane proteins can screen for potential interactors, though false positives are common and results require validation through other methods.

  • Proximity-based labeling: Techniques like BioID or APEX, where ANT1 is fused to a promiscuous biotin ligase or peroxidase that biotinylates nearby proteins, allowing for identification of the proximal proteome.

  • Crosslinking mass spectrometry: Chemical crosslinkers coupled with mass spectrometry can capture transient interactions and provide structural information about the interaction interface.

For cotton specifically, these approaches should be optimized considering the specialized extraction protocols needed for plant mitochondrial membranes, which typically require gradual solubilization steps to maintain protein complex integrity.

How can CRISPR-Cas9 gene editing be optimized for studying ANT1 function in cotton?

Optimizing CRISPR-Cas9 for cotton ANT1 modification requires addressing several cotton-specific challenges:

  • Guide RNA design: Select target sites with minimal off-target effects by analyzing the cotton genome for sequence uniqueness. For ANT1, consider targeting conserved functional domains for knockout studies or the promoter region for expression modulation. Cotton's polyploid nature requires careful gRNA design to target all homeologs if complete knockout is desired.

  • Delivery methods: Agrobacterium-mediated transformation remains the most efficient for cotton, with embryogenic callus as the primary target tissue. Optimization of infection time (typically 20-30 minutes), co-cultivation period (48-72 hours), and selection parameters improves transformation efficiency.

  • Verification strategies:

    • PCR-RE assay for initial screening

    • T7E1 assay for mutation detection

    • Deep sequencing to precisely characterize mutations

    • qRT-PCR and western blotting to confirm altered expression/translation

  • Phenotypic analysis protocol:

    • Mitochondrial isolation using differential centrifugation

    • Oxygen consumption measurements

    • ATP/ADP ratio determination in different cellular compartments

    • Stress tolerance assays (particularly salt and temperature stress based on introgression studies with related cotton species)

This approach can be particularly valuable for comparing ANT1 function between different cotton species, such as G. hirsutum and G. arboreum, potentially revealing mechanisms underlying differences in stress tolerance .

How does ANT1 function relate to salt tolerance mechanisms in cotton?

The relationship between ANT1 and salt tolerance in cotton involves several interconnected mechanisms:

  • Energy homeostasis: ANT1 likely plays a crucial role in maintaining mitochondrial ATP export during salt stress, which is essential for powering ion transporters that exclude Na+ from the cytosol or sequester it into vacuoles.

  • ROS management: Salt stress induces oxidative stress in cotton. ANT1 activity affects mitochondrial membrane potential, which in turn influences reactive oxygen species (ROS) production. Proper ANT1 function may help mitigate oxidative damage during stress conditions.

  • Hormonal crosstalk: Research on cotton stress responses shows that JA signaling pathway components like JAZ1 significantly influence salt tolerance . ANT1 function may be regulated by or interact with these hormonal signaling networks, as energy metabolism adjustments are key components of stress responses.

Experimental evidence from related studies indicates that salt-tolerant cotton varieties show different expression patterns of mitochondrial proteins compared to sensitive varieties. For example, overexpression of G. arboreum JAZ1 in G. hirsutum significantly increased salt tolerance, promoting root development and reprogramming the expression of defense-related genes . By analogy, ANT1 variants from different cotton species might contribute differently to energy metabolism under salt stress.

To experimentally investigate ANT1's role in salt stress responses:

  • Compare ANT1 expression levels before and after salt treatment using qRT-PCR

  • Assess mitochondrial ATP transport activity in isolated mitochondria from control and salt-stressed plants

  • Analyze phenotypes of ANT1-overexpressing or ANT1-silenced cotton lines under salt stress conditions

What methods best measure ANT1 transport activity in isolated cotton mitochondria?

Several complementary methods can accurately measure ANT1 transport activity:

  • Radioisotope transport assay: The gold standard approach uses radiolabeled substrates ([³H]-ATP or [¹⁴C]-ADP) to directly measure exchange rates across the mitochondrial membrane. For cotton mitochondria isolation, a buffer containing 0.3 M mannitol, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, and 0.1% BSA typically preserves functional integrity.

  • Fluorescent nucleotide analogs: ATP analogs like TNP-ATP exhibit fluorescence changes upon binding, allowing real-time monitoring of transport activity without radioactivity.

  • Membrane potential measurements: Using potentiometric dyes such as JC-1 or TMRM to monitor changes in mitochondrial membrane potential during ADP/ATP exchange.

  • Luciferase-based ATP detection: For measuring ATP export in semi-intact systems or isolated mitochondria.

  • Reconstitution approach: For definitive characterization, purified recombinant ANT1 can be reconstituted into liposomes pre-loaded with ATP or ADP, followed by measurement of substrate exchange rates.

MethodSensitivityTechnical DifficultyEquipment RequirementsAdvantages
Radioisotope assayVery highHighScintillation counterDirect quantification of transport
Fluorescent analogsMediumMediumFluorescence spectrophotometerReal-time measurements
Membrane potentialMediumMediumFluorescence spectrophotometerNon-invasive monitoring
Luciferase assayHighMediumLuminometerHigh throughput potential
ReconstitutionHighVery highVariousIsolated protein activity

Protocol optimization for cotton mitochondria typically requires adjusting osmolarity and ATP concentrations to account for tissue-specific differences in mitochondrial properties.

How does ANT1 from G. hirsutum compare with orthologs from other Gossypium species?

Comparative analysis of ANT1 across Gossypium species reveals insights into functional evolution and potential stress adaptation mechanisms:

  • Sequence conservation: While the core functional domains of ANT1 are likely highly conserved across cotton species due to the essential nature of ADP/ATP transport, variations in regulatory regions and amino acid substitutions in less critical regions may exist between species like G. hirsutum and G. arboreum.

  • Expression patterns: Based on transcriptomic studies of other genes, G. arboreum often shows different expression patterns for stress-related genes compared to G. hirsutum . RNA sequencing data from comparative studies would be necessary to determine if ANT1 expression differs between species under normal or stress conditions.

  • Functional differences: G. arboreum possesses robust defense mechanisms against biotic and abiotic stresses despite its lower yield and fiber quality compared to G. hirsutum . This suggests potential differences in energy metabolism genes like ANT1 that might contribute to stress tolerance.

Research approaches for comparative studies:

  • Cloning and sequence analysis of ANT1 from multiple Gossypium species

  • Heterologous expression of different species' ANT1 variants followed by transport activity assays

  • Creation of chimeric proteins to identify domains responsible for functional differences

  • Complementation studies in model systems to assess functional equivalence

  • Development of introgression lines containing ANT1 from G. arboreum in G. hirsutum background using methods similar to those described in the literature

Building on existing introgression research methodologies, chromosome segment introgression lines (ILs) could be developed to specifically study the effects of ANT1 variants from different cotton species in a common genetic background .

How can structural biology approaches advance our understanding of cotton ANT1?

Structural biology offers several promising approaches to elucidate cotton ANT1 function:

  • X-ray crystallography: While challenging for membrane proteins, advances in crystallization techniques for mitochondrial carriers have made this approach more feasible. For cotton ANT1, vapor diffusion crystallization using detergents like DDM or LDAO supplemented with specific lipids may improve crystal formation. Resolution is typically limited to 3-3.5 Å for similar carrier proteins.

  • Cryo-electron microscopy (cryo-EM): Single-particle cryo-EM has revolutionized membrane protein structural biology. For ANT1, this approach can reveal conformational states during the transport cycle without crystallization requirements. Sample preparation would involve purification in amphipol A8-35 or nanodiscs rather than traditional detergents.

  • NMR spectroscopy: While challenging for full-length ANT1, solution NMR can provide dynamic information about specific domains. Solid-state NMR offers another avenue for studying the protein in a membrane-like environment.

  • Molecular dynamics simulations: Computational approaches can model ANT1 behavior in a lipid bilayer, predicting conformational changes during transport and effects of mutations. These simulations require initial structural models based on homology with known structures of mitochondrial carriers.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of structural flexibility and conformational changes upon substrate binding without requiring crystallization.

These approaches are particularly valuable for understanding how structural differences in ANT1 between cotton species like G. hirsutum and G. arboreum might contribute to differences in stress tolerance .

What are the potential applications of ANT1 in improving cotton stress tolerance through genetic engineering?

Based on current understanding of mitochondrial function in stress responses and introgression studies in cotton, several ANT1-focused genetic engineering strategies could enhance cotton stress tolerance:

  • Variant substitution: Replacing native G. hirsutum ANT1 with variants from stress-tolerant G. arboreum could potentially enhance energy metabolism efficiency under stress conditions. This approach builds on successful introgression of other G. arboreum genes into G. hirsutum .

  • Expression modulation: Fine-tuning ANT1 expression levels through promoter engineering or CRISPR-based transcriptional regulation could optimize mitochondrial ATP export during stress responses. Based on studies with other genes, stress-inducible promoters often provide better results than constitutive overexpression .

  • Protein engineering: Creating chimeric ANT1 proteins that combine beneficial properties from different cotton species or introducing specific mutations that enhance transport efficiency under stress conditions.

  • Co-engineering approach: Simultaneous modification of ANT1 and interacting proteins in related pathways, such as components of the JA signaling pathway that have demonstrated roles in cotton salt tolerance .

Experimental validation would require:

  • Development of transgenic cotton lines using Agrobacterium-mediated transformation

  • Phenotypic evaluation under controlled stress conditions

  • Field trials in saline-alkaline soils similar to those used in previous cotton stress tolerance studies

  • Comprehensive physiological analysis including photosynthetic efficiency, ROS levels, and energy status measurements

The success of previous G. arboreum gene introductions into G. hirsutum provides a promising precedent for ANT1-based improvements .

How might ANT1 function integrate with broader signaling networks during cotton stress responses?

ANT1 likely functions within a complex network of stress-responsive pathways in cotton:

  • Hormone signaling integration: Cotton stress responses involve phytohormone signaling networks, particularly JA signaling. For example, GaJAZ1 interacts with GaMYC2 to repress expression of downstream genes with G-box cis elements in their promoters . ANT1 expression and activity may be regulated by these hormone signaling pathways to coordinate energy metabolism with stress responses.

  • Retrograde signaling: Mitochondrial function, which ANT1 directly influences, generates retrograde signals that regulate nuclear gene expression. Changes in ATP/ADP ratios, ROS production, and metabolite levels serve as signals that trigger adaptive transcriptional responses.

  • Calcium signaling: Mitochondria act as calcium stores, and calcium flux affects ANT1 activity. This creates a potential regulatory link between ANT1 function and calcium-dependent signaling pathways activated during stress.

  • Metabolic regulation: ANT1-mediated changes in cytosolic ATP availability influence numerous ATP-dependent processes including kinase activities, which in turn regulate many stress response pathways.

Research approaches to understand these integrations include:

  • Transcriptomic analysis comparing wild-type and ANT1-modified cotton under stress conditions

  • Metabolomic profiling to identify changes in key signaling molecules

  • Phosphoproteomic analysis to detect altered kinase activities

  • Network analysis integrating these multi-omics datasets

High-throughput RNA sequencing approaches similar to those used in previous cotton stress studies would be particularly valuable for placing ANT1 function within the broader context of stress-responsive gene networks.

How has ANT1 evolved across the Gossypium genus and what does this reveal about functional adaptations?

Evolutionary analysis of ANT1 across the Gossypium genus can provide insights into functional adaptations:

  • Sequence conservation patterns: Coding regions critical for ADP/ATP transport function likely show high conservation, while regulatory regions and less critical domains may exhibit greater divergence between species adapted to different environments.

  • Selection pressure analysis: Calculating Ka/Ks ratios (non-synonymous to synonymous substitution rates) across ANT1 sequences from different cotton species can identify regions under positive, neutral, or purifying selection.

  • Promoter evolution: Comparison of ANT1 promoter regions across species may reveal differences in regulatory elements that influence expression patterns under stress conditions, potentially contributing to the robust stress defense observed in G. arboreum .

  • Polyploidization effects: G. hirsutum (AADD genome) contains homeologous copies of ANT1 from its A and D genome progenitors. Analysis of expression bias between these homeologs and comparison with the ANT1 from diploid G. arboreum (A2 genome) can reveal subfunctionalization or neofunctionalization following polyploidization.

Methodological approaches include:

  • Phylogenetic analysis of ANT1 sequences across multiple Gossypium species and relatives

  • Comparative transcriptomics to assess expression patterns across species

  • Functional complementation studies to test interchangeability of ANT1 variants

  • Analysis of syntenic regions containing ANT1 to understand genomic context evolution

This evolutionary perspective is particularly relevant given the documented differences in stress tolerance between G. arboreum and G. hirsutum , and could guide identification of beneficial ANT1 variants for cotton improvement.

What techniques are most appropriate for studying ANT1 expression patterns across different cotton tissues and developmental stages?

Several complementary techniques provide comprehensive insight into ANT1 expression patterns:

TechniqueResolutionQuantitative AccuracyThroughputSpatial Information
RT-qPCRGene-specificHighMediumNone
RNA-seqGenome-wideHighHighNone
In situ hybridizationGene-specificMediumLowHigh (cellular)
Promoter-reporter fusionGene-specificMediumLowHigh (tissue)
ImmunolocalizationProtein-specificMediumLowHigh (subcellular)

For cotton-specific applications:

  • RT-qPCR optimization: Design primers specific to ANT1 that can distinguish between homeologs in polyploid cotton. Reference genes should be carefully selected based on stability across tested conditions, with cotton histone or ubiquitin genes typically performing well.

  • RNA-seq analysis: High-throughput sequencing can provide comprehensive expression profiles across tissues, developmental stages, and stress conditions. For cotton, strand-specific libraries with at least 20 million reads per sample are recommended for accurate quantification.

  • Tissue-specific profiling: Based on studies of other mitochondrial proteins, key tissues to analyze include:

    • Root apex (high energy demand for growth)

    • Developing fibers (metabolically active during elongation)

    • Leaves (under various stress conditions)

    • Developing seeds (high energy requirements)

  • Promoter analysis: Cloning the native ANT1 promoter (approximately 2 kb upstream region) and fusing it with reporter genes like GUS or fluorescent proteins can reveal spatial and temporal expression patterns in transgenic cotton.

These approaches can be particularly valuable for comparing ANT1 expression between G. hirsutum and G. arboreum, potentially revealing differences that contribute to their distinct stress tolerance profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.