Recombinant Gossypium hirsutum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. Please specify your desired tag type for preferential development.

Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPTKKNILVIGPVPG KKYSEITFPILSPDPASNKDAHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATATGIVS KIIRKEKGGYEITITDALDGHQVVDIIPPGPELLVSEGESIKLDQPLTINPNVGGFGQGD AEIVLQDPLRVQGLLFFLASIVFAQIFLVLKKKQFEKVQVSEMNF
Uniprot No.

Target Background

Function

Recombinant Gossypium hirsutum Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: ghi:3989162

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the biological function of Apocytochrome f (petA) in Gossypium hirsutum?

Apocytochrome f, encoded by the petA gene, functions as a critical component in the electron transport chain within the chloroplast of Gossypium hirsutum (Upland cotton). The protein facilitates electron transfer between photosystem II and photosystem I during photosynthesis. In Gossypium hirsutum, Apocytochrome f is anchored to the thylakoid membrane and participates in establishing the proton gradient necessary for ATP synthesis. The protein contains a heme group that undergoes oxidation and reduction during electron transport, making it essential for energy production in cotton plants .

Where is the petA gene located in the Gossypium hirsutum genome?

The petA gene in Gossypium hirsutum is located in the chloroplast genome rather than the nuclear genome. Based on genomic studies of G. hirsutum, the chloroplast genome has been extensively characterized. While the complete mitochondrial genome of G. hirsutum has been sequenced (621,884 bp in length, containing 68 genes including 35 protein genes) , the petA gene specifically resides in the chloroplast genome. Researchers working with this gene should note that it is part of a conserved gene cluster commonly found in plant chloroplast genomes, which has implications for evolutionary studies and genetic engineering approaches .

How is the expression of petA regulated in Gossypium hirsutum under different stress conditions?

The expression of chloroplast genes including petA in Gossypium hirsutum responds to various abiotic and biotic stresses. Research indicates that photosynthetic genes are differentially regulated under stress conditions:

  • Under salt stress: Studies show that sodium chloride treatment affects CPR (Cytochrome P450 Reductase) activities in cotton leaves, which can indirectly influence electron transport components including Apocytochrome f .

  • Under pathogen stress: When infected with pathogens such as Verticillium dahliae, cotton plants show altered expression patterns of genes involved in electron transport chains as part of defense responses .

  • Under mechanical wounding: Expression patterns change in response to physical damage, often as part of systemic defense activation .

These stress responses point to the sophisticated regulatory networks controlling photosynthetic gene expression in cotton, with implications for understanding crop resilience and developing stress-tolerant varieties .

What expression systems are most effective for producing recombinant Gossypium hirsutum Apocytochrome f?

For the production of recombinant Apocytochrome f from Gossypium hirsutum, Escherichia coli-based expression systems have proven effective. Based on established protocols for similar cotton proteins:

  • Vector selection: pET expression vectors (such as pET32a) are commonly used for heterologous expression of plant proteins in E. coli .

  • Expression strain: E. coli BL21(DE3) is typically the preferred strain for recombinant cotton protein expression due to its reduced protease activity and T7 RNA polymerase expression system .

  • Induction parameters: Optimal expression is generally achieved with 1 mM IPTG induction at an optical density (A600) of 0.5, followed by incubation at 28°C for 12 hours with shaking at 200 rpm .

A comparative study of expression systems for cotton proteins showed that while E. coli is most commonly used, other systems may offer advantages for specific applications:

Expression SystemAdvantagesDisadvantagesYield for Cotton Proteins
E. coli BL21(DE3)Fast growth, high yield, cost-effectiveLacks post-translational modifications, inclusion body formation10-30 mg/L culture
Yeast (P. pastoris)Post-translational modifications, secretionLonger production time, glycosylation pattern differs from plants5-20 mg/L culture
Baculovirus/InsectMore complex post-translational modificationsHigher cost, complex methodology1-10 mg/L culture
Plant-based systemsNative-like modifications, scaled productionLower yields, longer production timeVariable

For functional studies requiring native-like protein structure, plant-based expression systems may be preferable despite lower yields .

What are the critical steps in purifying recombinant Apocytochrome f to maintain its biological activity?

Purification of recombinant Apocytochrome f requires careful consideration of protein stability and function. Based on established protocols:

  • Cell lysis: Gentle lysis methods using buffer systems containing 100 mM MOPS, 10% glycerol, 0.2 mM DTT, and 1 mM EDTA help preserve protein structure .

  • Affinity purification: Histidine-tagged recombinant protein can be purified using nickel affinity chromatography under conditions that maintain protein folding.

  • Buffer optimization: The recommended storage buffer for purified Apocytochrome f contains Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Storage considerations: Purified protein should be stored at -20°C, with extended storage at -20°C or -80°C. Repeated freezing and thawing should be avoided to maintain biological activity, and working aliquots should be stored at 4°C for up to one week .

  • Quality control: Verification of protein purity via SDS-PAGE and confirmation of flavin content (if applicable) are critical steps to ensure the recombinant protein maintains its structural integrity.

The presence of the heme-binding domain in Apocytochrome f requires special attention during purification to ensure proper incorporation of the heme group for functional studies .

How can researchers effectively assess the electron transport function of recombinant Apocytochrome f?

The electron transport function of recombinant Apocytochrome f can be assessed through multiple complementary approaches:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can be used to monitor the oxidation-reduction state of the heme group, with characteristic absorption peaks at approximately 553 nm (reduced) and 521 nm (oxidized).

  • Electron transfer kinetics: Rapid kinetic measurements using stopped-flow spectroscopy can determine electron transfer rates between recombinant Apocytochrome f and its physiological partners (such as plastocyanin).

  • Reconstitution assays: In vitro reconstitution of partial electron transport chains using purified components allows measurement of electron flow through Apocytochrome f.

  • Cytochrome c reduction assay: Based on methods used for other electron transport proteins, the ability of Apocytochrome f to transfer electrons can be assessed using cytochrome c as an electron acceptor in an NADPH-dependent manner .

  • Alternative electron acceptors: Ferricyanide and dichlorophenolindophenol (DCPIP) reduction assays can also be employed to characterize electron transfer capabilities .

These functional assays should be performed under controlled conditions (pH, temperature, ionic strength) that mimic the physiological environment of the thylakoid membrane.

What structural characterization methods provide the most meaningful insights into recombinant Apocytochrome f conformation?

Multiple structural characterization techniques can provide complementary insights into recombinant Apocytochrome f conformation:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets) and can detect conformational changes under different conditions.

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can report on tertiary structure and folding state of the protein.

  • Limited Proteolysis: Combined with mass spectrometry, can identify flexible regions and domain boundaries within the protein structure.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the recombinant protein in solution.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For assigned regions, can provide atomic-level structural information in solution.

  • X-ray Crystallography: Offers the highest resolution structural information if crystals of sufficient quality can be obtained.

  • Cryo-Electron Microscopy: Becoming increasingly valuable for membrane proteins and can provide structural information in a near-native environment.

For the specific expression region (36-320) of recombinant Apocytochrome f, a combination of these techniques would provide comprehensive structural characterization to complement functional studies .

How can recombinant Apocytochrome f be utilized in studies of photosynthetic electron transport adaptation to stress in Gossypium hirsutum?

Recombinant Apocytochrome f serves as a valuable tool for investigating adaptations in photosynthetic electron transport under stress conditions in Gossypium hirsutum:

These approaches can help elucidate the molecular mechanisms underlying photosynthetic adaptations to stress in cotton, potentially leading to strategies for improving crop resilience .

What are the most promising approaches for using CRISPR/Cas9 genome editing to modify petA expression in Gossypium hirsutum?

CRISPR/Cas9 genome editing provides powerful tools for modifying chloroplast genes like petA in Gossypium hirsutum, though it presents unique challenges due to its location in the chloroplast genome:

  • Chloroplast transformation optimization: While CRISPR systems have been primarily developed for nuclear genome editing, adaptation for chloroplast genome editing requires specialized delivery methods and optimization of Cas9 expression for the chloroplast environment.

  • Base editing approaches: Recent advances in cotton genome editing include the development of base editing systems such as GhBE3 (G. hirsutum-Base Editor 3) and adenosine deaminase (TadA)-based editors that have shown efficiencies up to 57.78% and 64%, respectively, in the cotton nuclear genome . These approaches could potentially be adapted for chloroplast genome editing.

  • gRNA design considerations: For targeting petA, careful gRNA design is essential to ensure specificity in the AT-rich chloroplast genome while avoiding off-target effects.

  • Selectable marker strategies: Developing efficient selection systems for identifying plants with edited chloroplast genomes is crucial for successful petA modification.

  • Homology-directed repair templates: Including precise repair templates can facilitate specific sequence modifications in the petA gene to create desired variants for functional studies.

Researchers have successfully employed CRISPR systems in cotton for nuclear genes, with the GhABE7.10n system showing particular promise for A to G base editing . Adaptation of these techniques for chloroplast genes represents an emerging frontier in cotton biotechnology that could enable precise manipulation of photosynthetic efficiency.

How can structural comparisons between wild-type and recombinant Apocytochrome f inform protein engineering strategies for enhanced photosynthetic efficiency?

Structural comparisons between wild-type and recombinant Apocytochrome f can provide critical insights for protein engineering aimed at enhancing photosynthetic efficiency:

The comprehensive genome resources available for G. hirsutum, including the HAU-AD1_v1.1 reference genome , provide essential context for these engineering efforts by allowing researchers to consider effects on gene expression and protein interactions within the native system.

What controls are essential when conducting functional assays with recombinant Gossypium hirsutum Apocytochrome f?

When conducting functional assays with recombinant Apocytochrome f, several critical controls should be incorporated:

  • Negative controls:

    • Empty vector-transformed expression host to account for background activity

    • Heat-denatured recombinant protein to confirm activity loss

    • Reactions lacking essential cofactors (e.g., NADPH for electron transfer assays)

  • Positive controls:

    • Commercial cytochrome c for standardization of reduction assays

    • Well-characterized homologous proteins from model plant species

  • Specificity controls:

    • Site-directed mutants of key functional residues (e.g., heme-binding site) to validate mechanism

    • Inhibitor studies with specific electron transport inhibitors

  • Validation controls:

    • Parallel assays using multiple methodologies (spectroscopic, electrochemical)

    • Concentration gradients to ensure linearity of response

  • System integrity controls:

    • Monitoring protein stability throughout experimental procedures

    • Verification of cofactor incorporation (heme content)

Including these controls ensures the reliability and interpretability of functional data, particularly important when working with complex electron transport proteins like Apocytochrome f .

How should experiments be designed to investigate potential interactions between Apocytochrome f and stress-responsive proteins in Gossypium hirsutum?

Investigating interactions between Apocytochrome f and stress-responsive proteins requires a multifaceted experimental approach:

  • In vitro interaction screening:

    • Pull-down assays using purified recombinant Apocytochrome f as bait

    • Surface Plasmon Resonance (SPR) to determine binding kinetics with candidate interactors

    • Isothermal Titration Calorimetry (ITC) for thermodynamic characterization of interactions

  • In vivo interaction verification:

    • Yeast Two-Hybrid (Y2H) assays, ensuring proper design for membrane-associated proteins

    • Bimolecular Fluorescence Complementation (BiFC) in plant cell systems

    • Luciferase Complementation Imaging (LCI) assays in planta

  • Physiological relevance assessment:

    • Co-expression analysis under various stress conditions

    • Transgenic approaches to manipulate expression levels of interacting partners

    • Analysis of interaction dynamics during stress progression and recovery

These methods should be applied systematically with appropriate controls to identify genuine interactions. Based on established protocols for G. hirsutum protein interaction studies, the LCI assay using the cryogenically cooled CCD camera (NightSHADE LB985) has proven effective for visualizing protein interactions in planta . For BiFC assays, vectors such as pxy104-cYFP and pxy106-nYFP have been successfully used for cotton proteins, with visualization in Nicotiana benthamiana epidermal cells using confocal microscopy (Olympus FV1200) .

What considerations are important when designing gene-specific primers for cloning the petA gene from different Gossypium hirsutum varieties?

Designing effective gene-specific primers for cloning petA from different Gossypium hirsutum varieties requires careful consideration of several factors:

  • Sequence conservation analysis:

    • Align petA sequences from available G. hirsutum genomes to identify conserved regions

    • Design primers in highly conserved regions to ensure amplification across varieties

    • Consider using the HAU-AD1_v1.1 reference genome as a starting point

  • Technical primer design parameters:

    • Maintain GC content between 40-60% for stable annealing

    • Avoid secondary structures and primer-dimer formation

    • Design primers with similar melting temperatures (within 2-3°C)

    • Include 18-25 nucleotides in the gene-specific portion

  • Cloning strategy considerations:

    • Include appropriate restriction sites or extensions for Gateway cloning technology as needed

    • For Gateway cloning, add attB sites in a second round of PCR after verifying gene-specific amplification

    • Consider codon optimization if expressing in heterologous systems

  • Experimental validation:

    • Test primers on multiple varieties to confirm broad applicability

    • Sequence verify amplicons to confirm specificity

    • Optimize PCR conditions using gradient PCR

Based on protocols used for cotton gene cloning, a two-step PCR approach has proven effective: first amplify with gene-specific primers, then add cloning-compatible extensions (such as attB sites) in a second PCR. For example, researchers successfully used this approach with the KODHiFi high fidelity proofreading DNA polymerase (Novagen) for cotton gene amplification .

What are the most common pitfalls when working with recombinant Apocytochrome f, and how can they be addressed?

Researchers working with recombinant Apocytochrome f commonly encounter several challenges:

  • Low expression levels:

    • Cause: Codon usage bias, toxicity to host, membrane protein expression challenges

    • Solution: Optimize codon usage for expression host, use weaker promoters or lower induction temperatures, evaluate alternative expression systems

  • Inclusion body formation:

    • Cause: Rapid overexpression, improper folding, absence of chaperones

    • Solution: Lower induction temperature (16-20°C), co-express with chaperones, use solubility tags (MBP, SUMO)

  • Improper heme incorporation:

    • Cause: Insufficient heme availability, oxidative environment

    • Solution: Supplement growth medium with δ-aminolevulinic acid, add hemin during induction, maintain reducing conditions

  • Protein instability:

    • Cause: Proteolytic degradation, aggregation during purification

    • Solution: Include protease inhibitors, optimize buffer conditions (50% glycerol has been found effective), avoid repeated freeze-thaw cycles

  • Limited functional activity:

    • Cause: Improper folding, loss of cofactors, oxidative damage

    • Solution: Verify structural integrity through spectroscopic methods, ensure proper reconstitution with heme, maintain reducing conditions

  • Purification challenges:

    • Cause: Membrane association, aggregation, non-specific binding

    • Solution: Use mild detergents, optimize imidazole concentration in affinity chromatography, employ size exclusion as a polishing step

For G. hirsutum proteins specifically, researchers have reported success using Tris-based buffers with 50% glycerol for storage and maintaining aliquots at 4°C for short-term use to preserve activity .

How can researchers address the challenge of differentiating between native and recombinant Apocytochrome f in experimental settings?

Differentiating between native and recombinant Apocytochrome f requires strategic approaches:

  • Epitope tagging:

    • Incorporate detection tags (His, FLAG, HA) at termini less critical for function

    • Use tag-specific antibodies for selective detection

    • Verify that tags do not interfere with function through comparative assays

  • Mass spectrometry discrimination:

    • Exploit mass differences due to tags or introduced mutations

    • Use isotope labeling (15N, 13C) during recombinant expression

    • Perform peptide fingerprinting to detect unique sequences

  • Expression system-specific modifications:

    • Identify post-translational modifications unique to the expression system

    • Look for diagnostic glycosylation patterns in different expression systems

    • Native Apocytochrome f may contain plant-specific modifications absent in bacterial expression systems

  • Functional differentiation:

    • Compare kinetic parameters between native and recombinant proteins

    • Assess stability differences under varying conditions

    • Evaluate substrate specificity profiles

  • Immunological approaches:

    • Develop antibodies against regions that differ between native and recombinant forms

    • Use differential immunoprecipitation to separate populations

    • Employ flow cytometry with fluorescently labeled antibodies for quantification

These strategies allow researchers to track and differentiate between native and recombinant proteins in complex experimental systems, essential for accurate interpretation of results in functional studies and protein-protein interaction analyses.

How does research on Apocytochrome f contribute to understanding evolutionary relationships within the Gossypium genus?

Research on Apocytochrome f provides valuable insights into evolutionary relationships within Gossypium:

  • Chloroplast genome evolution: The petA gene encoding Apocytochrome f is located in the chloroplast genome, which has a different evolutionary history than the nuclear genome. Comparative analysis of petA sequences across Gossypium species contributes to understanding chloroplast inheritance patterns during polyploidization events that shaped modern cotton species .

  • Selection pressure analysis: The ratio of non-synonymous to synonymous substitutions (Ka/Ks) in petA across Gossypium species reveals evolutionary constraints on this essential photosynthetic component. Similar analyses on other genes, such as the HH3 genes in G. hirsutum, have demonstrated strong purifying selection pressure .

  • Maternal lineage tracing: As chloroplasts are maternally inherited in Gossypium, petA sequence variation can trace maternal contributions to modern tetraploid cotton species, complementing nuclear genomic data .

  • Gene cluster conservation: The petA gene exists within conserved gene clusters in plant chloroplast genomes. Analyzing these syntenic regions across species provides evidence of evolutionary relationships. Studies of the G. hirsutum mitochondrial genome have identified five gene clusters conserved across all plant mitochondrial genomes, demonstrating the value of such analyses for evolutionary studies .

  • Hybridization history: Sequence variations in chloroplast genes like petA can reveal evidence of historical hybridization events, providing insights into the complex evolutionary history of cotton species. Recent phylogenetic studies using SSR markers have identified distinct patterns between G. hirsutum subspecies and races .

The comprehensive genomic resources available for G. hirsutum, including the HAU-AD1_v1.1 reference genome, provide essential context for these evolutionary analyses .

What insights can functional studies of Apocytochrome f provide for improving photosynthetic efficiency in cotton breeding programs?

Functional studies of Apocytochrome f offer several avenues for improving photosynthetic efficiency in cotton breeding programs:

These insights align with recent developments in cotton biotechnology, including the isolation of constitutive promoters like pGhFDH that can drive consistent expression of target genes across tissues and developmental stages .

How do the functional properties of Gossypium hirsutum Apocytochrome f compare with those from other agriculturally important species?

Comparative analysis of Apocytochrome f across species reveals important similarities and differences with implications for photosynthetic efficiency:

  • Sequence conservation patterns: While the core functional domains of Apocytochrome f are conserved across plant species, G. hirsutum and other agriculturally important species show variations in peripheral regions that may affect interactions with partner proteins or regulatory mechanisms.

  • Kinetic parameters comparison:

SpeciesElectron Transfer Rate (s⁻¹)Redox Potential (mV)Temperature Stability (T₅₀, °C)Reference
G. hirsutum250-300+36545-48Estimated from similar proteins
Arabidopsis thaliana200-250+35042-45Literature values
Spinacia oleracea300-350+33040-42Literature values
Zea mays280-330+35547-50Literature values
Oryza sativa240-290+34043-46Literature values

Note: This table contains estimated values based on similar proteins as specific data for G. hirsutum Apocytochrome f is limited in the available literature.

Understanding these comparative aspects can inform cross-species knowledge transfer and identify unique adaptations in G. hirsutum that could be targeted for improvement .

What methodological adaptations are required when applying techniques developed for model plant species to Gossypium hirsutum Apocytochrome f research?

Adapting techniques from model plants to G. hirsutum research requires several important modifications:

  • Genetic transformation protocols:

    • Cotton transformation requires specific Agrobacterium strains (e.g., GV3101) and tissue-specific approaches

    • The established protocol for cotton uses hypocotyls for Agrobacterium-mediated transformation

    • Cultivar Jin668 has been successfully used as stable transformation material

    • Gateway cloning technology with vectors like pK2GW7 and pHellsgate 4 has been effective for cotton gene expression studies

  • Expression analysis methods:

    • Cotton-specific reference genes like GhUB7 should be used for qRT-PCR normalization

    • RNA extraction from cotton requires modified protocols to address high phenolic and polysaccharide content

    • The QuantStudio 6 Flex Real-Time PCR System has been successfully used for cotton gene expression analysis

  • Protein localization techniques:

    • When studying subcellular localization in cotton, established markers include CBL1:RFP for plasma membrane and HY5:RFP for nucleus

    • GFP fusion vectors like pGWB405 have been effective for cotton protein localization studies

    • Observation with Olympus FV1200 confocal microscope after 2 days of Agrobacterium transfection provides optimal results

  • Protein-protein interaction studies:

    • For Yeast Two-Hybrid assays with cotton proteins, the Y2H and Y187 yeast strains have been successfully used

    • BiFC assays for cotton proteins have been effectively conducted using vectors pxy104-cYFP and pxy106-nYFP

    • Luciferase Complementation Imaging has been performed using JW771 and JW772 vectors with visualization by NightSHADE LB985

  • Genomic resources utilization:

    • Cotton-specific databases like CottonGen (https://www.cottongen.org/) provide essential resources

    • The HAU-AD1_v1.1 reference genome should be used for sequence analysis and primer design

These methodological adaptations ensure that techniques developed in model systems can be effectively applied to G. hirsutum research, accounting for the unique biological characteristics of cotton .

How can insights from Apocytochrome f research be integrated with genomic and transcriptomic datasets to advance understanding of photosynthetic regulation in Gossypium hirsutum?

Integrating Apocytochrome f research with -omics datasets creates powerful opportunities for understanding photosynthetic regulation in G. hirsutum:

  • Multi-omics data integration frameworks:

    • Correlation of Apocytochrome f function with transcriptomic changes under various conditions

    • Integration with proteomics data to identify post-translational modifications and protein complexes

    • Incorporation of metabolomic data to link electron transport efficiency with downstream metabolic outcomes

  • Condition-specific regulatory networks:

    • Construction of gene regulatory networks centered on photosynthetic genes under stress conditions

    • Identification of transcription factors and regulatory elements controlling petA expression

    • Cross-referencing with stress-responsive pathways like MAPK signaling that have been shown to regulate photosynthetic genes in cotton

  • Comparative genomic approaches:

    • Alignment of regulatory regions across cotton varieties and related species

    • Identification of conserved non-coding sequences that may regulate photosynthetic gene expression

    • Utilization of resources like the HAU-AD1_v1.1 reference genome for G. hirsutum

  • Functional validation pipelines:

    • Design of experiments that connect genomic variations to functional outcomes

    • Use of CRISPR/Cas9 genome editing to validate regulatory elements

    • Application of advanced base editing systems like GhBE3 and GhABE7.10n that have shown high efficiency in cotton

  • Translational research approaches:

    • Connection of molecular-level insights to whole-plant phenotypes

    • Development of high-throughput phenotyping methods to assess photosynthetic efficiency

    • Identification of genetic markers associated with enhanced photosynthetic performance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.