Recombinant Gossypium hirsutum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
atpI
Target Protein Sequence
MNGISNALNGLYDISGVEVGQHFYWQIAGFQVHAQVLITSWVVIAILLGSAVIAVRNPQT IPTAGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIQLP HGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDFTKP LSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIGESM EGHH
Uniprot No.

Target Background

Function

Function: Key component of the proton channel; plays a direct role in proton translocation across the membrane.

Database Links

KEGG: ghi:3989193

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of chloroplastic ATP synthase in Gossypium hirsutum?

Chloroplastic ATP synthase in cotton (Gossypium hirsutum) is a multisubunit enzyme complex located in the thylakoid membrane that catalyzes ATP synthesis during photosynthesis. The complex consists of two main parts: the membrane-embedded Fo portion (containing subunits a, b, and c) and the catalytic F1 portion (containing subunits α, β, γ, δ, and ε). The ATP synthase harnesses the proton gradient established across the thylakoid membrane during photosynthetic electron transport to drive ATP synthesis. In cotton, ATP synthase plays essential roles in energy production and various physiological processes, including fiber development and stress responses. Comparative analyses have shown that while the bacterial ATP synthase is simpler, it performs the same core functions as the more complex chloroplastic and mitochondrial ATP synthases .

How do mutations in ATP synthase subunit genes affect plant development in cotton?

Mutations in ATP synthase subunit genes can significantly impact plant development in cotton by disrupting energy metabolism. Research on cotton CMS line Jin A shows that altered expression and sequence variations in ATP synthase subunit genes correlate with abnormal development, particularly in reproductive tissues . Single nucleotide polymorphisms (SNPs) in ATP synthase subunit genes, including atpB, atpE, and atpF, have been identified when comparing the Jin A-CMS chloroplast genome with reference Gossypium hirsutum sequences . These mutations result in amino acid substitutions that potentially affect protein function and interaction with other subunits. For example, the atpE gene shows a K-R substitution at position 23, and atpF has an S-G substitution at position 50, which likely affects the structural integrity and catalytic efficiency of the ATP synthase complex .

What experimental evidence supports the role of ATP synthase in cotton fiber development?

Research indicates that ATP synthase activity correlates with cotton fiber elongation stages. Northern-blot analysis has demonstrated that genes related to energy metabolism, including those encoding ATP synthase subunits, are highly expressed during the elongation stages of cotton fiber differentiation . This suggests a critical role for ATP synthase in providing the energy required for cell elongation during fiber development. The temporal correlation between ATP synthase expression and fiber elongation provides strong evidence for its developmental significance. Reduced ATP content has been observed in plants with compromised ATP synthase function, which often exhibit growth abnormalities, supporting the enzyme's essential role in development processes that require significant energy input, such as fiber elongation .

What is the relationship between ATP synthase subunit expression and male sterility in cotton?

Studies on cytoplasmic male sterility (CMS) in cotton reveal an intricate relationship between ATP synthase subunit expression and male fertility. In the Jin A-CMS line, ATP synthase subunit genes atpB, atpE, and atpF show significantly lower expression levels at the microspore abortion stage compared to the maintainer line Jin B . This downregulation appears to disrupt energy metabolism in anthers, contributing to premature programmed cell death (PCD) of the tapetal layer. Quantitative qRT-PCR data confirms that atpB, atpE, and atpF are significantly downregulated during microspore abortion . Interestingly, in F1 three-line hybrids, which restore fertility, the expression levels of these ATP synthase genes are significantly higher than in the CMS line, suggesting that restored expression of these genes may contribute to fertility restoration .

How do ATP synthase subunits contribute to reactive oxygen species (ROS) metabolism in cotton?

ATP synthase subunits play a critical role in ROS metabolism in cotton. Research demonstrates that silencing of atpE and atpF genes leads to increased levels of H₂O₂ and singlet oxygen (¹O₂) in cotton leaves . The ε subunit (encoded by atpE) affects the morphology and structure of the thylakoid membrane near photosystem II through its specific interaction with CF1, which influences proton transport across the thylakoid membrane . When ATP synthase function is compromised due to downregulation of atpE and atpF, the resulting disruption in photosynthetic electron transport and proton gradients leads to increased ROS production. This mechanism explains the observed correlation between ATP synthase dysfunction and oxidative stress in cotton, particularly in CMS lines where excessive ROS accumulation contributes to premature PCD in the anther tapetum .

What are the regulatory mechanisms controlling ATP synthase gene expression during different developmental stages?

ATP synthase gene expression in cotton is regulated through complex mechanisms that respond to developmental cues and environmental conditions. Northern-blot analysis shows that annexin genes, which interact with ATP synthase function, are highly expressed during the elongation stages of cotton fiber differentiation . In reproductive tissues, ATP synthase subunit genes show tissue-specific and stage-specific expression patterns, with significant downregulation observed in CMS lines during microspore development . These differential expression patterns suggest sophisticated transcriptional control mechanisms that coordinate ATP synthase activity with developmental processes. Comparative analysis of expression in sterile, maintainer, and hybrid lines indicates that nuclear-cytoplasmic interactions play a significant role in regulating chloroplast ATP synthase gene expression, particularly in the context of male fertility .

What are the optimal methods for isolating and purifying recombinant ATP synthase subunits from Gossypium hirsutum?

The isolation and purification of recombinant ATP synthase subunits from cotton involve several critical steps. Based on established protocols for ATP synthase isolation:

  • Gene Cloning and Expression System Selection:

    • Clone the desired ATP synthase subunit cDNA from a cotton fiber cDNA library

    • Express the cDNA in a suitable expression system such as Escherichia coli

  • Protein Purification Process:

    • Harvest and lyse cells in an appropriate buffer (e.g., containing glycerol, sucrose, and protease inhibitors)

    • Solubilize membranes using a detergent such as glycol-diosgenin (GDN)

    • Perform affinity chromatography using His-tagged proteins and a HisTrap HP column

    • Use size exclusion chromatography (e.g., Superose 6 increase column) for final purification

  • Quality Control:

    • Assess purity by SDS-PAGE

    • Verify identity by Western blotting and mass spectrometry

    • Test functional activity using appropriate assays

This protocol has been successfully applied for the isolation of ATP synthase from various organisms and can be adapted for cotton ATP synthase subunits with appropriate modifications .

What assays are available for measuring ATP synthase activity in cotton tissue extracts?

Several complementary assays can be employed to measure ATP synthase activity in cotton tissue extracts:

  • ATPase/GTPase Activity Assays:

    • Measure inorganic phosphate release using colorimetric methods

    • Monitor activity in the presence of different divalent cations (e.g., Mg²⁺, Ca²⁺)

    • ATP synthase from cotton shows higher GTPase than ATPase activity

  • ATP Synthesis Measurement:

    • Use luciferase-based assays to quantify ATP production

    • Couple with proton gradient establishment using artificial liposomes

  • Nucleotide Binding Studies:

    • Employ photolabeling assays to determine specificity of nucleotide binding

    • Map binding sites using domain-deletion mutants

  • Enzyme Kinetics Analysis:

    • Determine Km and Vmax values for ATP hydrolysis and synthesis

    • Evaluate effects of various inhibitors and activators

Research has shown that recombinant annexin from cotton, which interacts with ATP metabolism, displays both ATPase and GTPase activities, with Mg²⁺ being essential for these activities while high Ca²⁺ concentrations are inhibitory .

How can gene silencing approaches be optimized to study ATP synthase subunit function in cotton?

Optimizing gene silencing approaches for studying ATP synthase subunits in cotton requires careful consideration of several factors:

  • Target Selection and Construct Design:

    • Select unique regions of the target gene to avoid off-target effects

    • Design effective hairpin or antisense constructs based on the target subunit sequence

    • Consider the specific subunit's function (e.g., atpE, atpF) in the ATP synthase complex

  • Delivery Methods:

    • Use Agrobacterium-mediated transformation for stable silencing

    • Employ virus-induced gene silencing (VIGS) for transient silencing studies

    • Consider tissue-specific promoters for targeted silencing

  • Validation and Analysis:

    • Confirm silencing efficiency using qRT-PCR

    • Analyze phenotypic effects, particularly on ROS levels and plant development

    • Monitor physiological parameters including ATP content and photosynthetic efficiency

Research has demonstrated that silencing atpE and atpF genes in cotton leads to increased ROS levels, providing a valuable approach to study the function of these subunits in ROS metabolism .

How should researchers interpret SNP variations in ATP synthase subunit genes between different cotton varieties?

Interpreting SNP variations in ATP synthase subunit genes requires a systematic approach:

  • Functional Impact Assessment:

    • Analyze whether SNPs result in amino acid substitutions

    • Evaluate the conservation of affected residues across species

    • Predict functional consequences using structural models and bioinformatic tools

  • Correlation with Phenotypic Traits:

    • Compare SNP patterns between varieties with different phenotypic characteristics

    • Analyze associations between SNPs and traits such as male sterility or stress tolerance

  • Comparative Analysis Framework:

GeneSNP PositionAmino Acid ChangePotential Functional ImpactReference
atpB9, 52V-A, Q-RMay affect catalytic activity
atpE23K-RAffects interaction with CF1
atpF50S-GInfluences membrane association

Sequence comparison between Jin A-CMS and reference Gossypium hirsutum reveals 29 chloroplast genes with SNP differences, including ATP synthase subunits that show amino acid substitutions potentially affecting protein function .

What statistical approaches are most appropriate for analyzing differential expression of ATP synthase genes?

When analyzing differential expression of ATP synthase genes in cotton, researchers should consider these statistical approaches:

  • Data Normalization Methods:

    • Use appropriate reference genes for qRT-PCR normalization

    • Apply RPKM/FPKM or TMM normalization for RNA-seq data

    • Consider tissue-specific reference genes for different developmental stages

  • Statistical Tests for Differential Expression:

    • For comparing two conditions: t-test or Wilcoxon rank-sum test

    • For multiple conditions: ANOVA followed by post-hoc tests (e.g., Tukey's multiple comparison test as used in the Jin A-CMS studies )

    • For RNA-seq data: DESeq2 or edgeR packages

  • Correlation and Network Analyses:

    • Use correlation analyses to identify genes co-expressed with ATP synthase subunits

    • Apply network approaches to understand regulatory relationships

Studies on Jin A-CMS employed appropriate statistical methods, including Tukey's multiple comparison tests, to identify significant differences in gene expression between sterile, maintainer, and hybrid lines .

How can proteomics approaches be used to study ATP synthase complex assembly in cotton chloroplasts?

Proteomics offers powerful tools for studying ATP synthase assembly in cotton chloroplasts:

  • Blue Native PAGE and 2D-PAGE:

    • Separate intact ATP synthase complexes and subcomplexes

    • Identify assembly intermediates and protein-protein interactions

    • Combine with western blotting to detect specific subunits

  • Mass Spectrometry-Based Approaches:

    • Use crosslinking mass spectrometry (XL-MS) to map subunit interactions

    • Apply quantitative proteomics to measure stoichiometry of subunits

    • Perform comparative proteomics between different developmental stages or tissues

  • Co-Immunoprecipitation and Proximity Labeling:

    • Isolate ATP synthase complexes and identify interacting partners

    • Use BioID or APEX2 proximity labeling to identify proteins in the vicinity of specific subunits

These methods can reveal critical insights into how mutations in atpI and other subunits affect the assembly and stability of the ATP synthase complex in cotton chloroplasts.

What are the best approaches for visualizing ATP synthase distribution and dynamics in cotton tissues?

Visualizing ATP synthase distribution and dynamics in cotton tissues requires specialized microscopy approaches:

  • Immunolocalization Techniques:

    • Generate subunit-specific antibodies for immunogold labeling

    • Use fluorescent secondary antibodies for confocal microscopy

    • Apply super-resolution microscopy (STORM, PALM) for detailed localization

  • Fluorescent Protein Fusions:

    • Create GFP fusions with ATP synthase subunits

    • Use tissue-specific promoters to study expression patterns

    • Employ FRET-based approaches to study subunit interactions

  • Live Cell Imaging:

    • Monitor ATP production using fluorescent ATP sensors

    • Track membrane potential changes using voltage-sensitive dyes

    • Visualize ROS production in relation to ATP synthase function

These visualization techniques can provide crucial information on the spatial and temporal dynamics of ATP synthase in different cotton tissues, particularly during fiber development and reproductive stages.

What are the key knowledge gaps in our understanding of recombinant Gossypium hirsutum ATP synthase subunit a?

Despite significant advances, several knowledge gaps remain regarding cotton ATP synthase:

  • Structural Information:

    • Detailed atomic structures of cotton-specific ATP synthase are lacking

    • Subunit-specific conformational changes during catalysis are poorly understood

    • The precise arrangement of subunits in the intact complex needs clarification

  • Regulatory Mechanisms:

    • The signaling pathways controlling ATP synthase gene expression remain unclear

    • Post-translational modifications affecting ATP synthase activity are underexplored

    • Environmental response mechanisms are not fully characterized

  • Tissue-Specific Functions:

    • The specialized roles of ATP synthase in fiber development beyond energy production

    • Differential regulation in reproductive versus vegetative tissues

    • The complete mechanism linking ATP synthase dysfunction to male sterility

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, molecular genetics, biochemistry, and advanced imaging techniques.

What emerging technologies might advance research on cotton ATP synthase subunits?

Several emerging technologies hold promise for advancing research on cotton ATP synthase:

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of cotton ATP synthase complexes

    • Visualize conformational states during catalysis

    • Map binding sites for regulators and inhibitors

  • Single-Molecule Techniques:

    • Measure rotation and conformational changes during ATP synthesis/hydrolysis

    • Determine kinetics of individual steps in the catalytic cycle

    • Study subunit dynamics in real-time

  • Genome Editing Technologies:

    • Create precise mutations in ATP synthase genes using CRISPR-Cas9

    • Generate reporter lines for monitoring ATP synthase expression and activity

    • Develop tissue-specific knockout or knockdown lines

  • Systems Biology Approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Model ATP synthase function in the context of whole-plant energy metabolism

    • Predict effects of genetic variations on ATP synthase function and plant phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.