Recombinant Gossypium hirsutum CASP-like protein XL3 (XL3)

What is Gossypium hirsutum CASP-like protein XL3 and what is its role in plant biology?

Gossypium hirsutum CASP-like protein XL3 (XL3) is a member of the Casparian strip membrane domain protein (CASP) family identified in upland cotton (Gossypium hirsutum). This protein plays a crucial role in the formation of Casparian strips in root endodermis. Casparian strips are specialized cell wall modifications that create barriers in the apoplastic space, controlling the movement of water and solutes between the soil and vascular tissues .

XL3, like other CASP proteins, appears to be involved in two primary activities: forming membrane scaffolds and directing modifications of the cell wall through interactions with secreted peroxidases to mediate lignin deposition . These functions are essential for regulating plant water and nutrient homeostasis. The protein likely contributes to the plant's ability to resist various environmental stresses by helping maintain the selective barrier properties of the root endodermis .

Casparian strips, which XL3 helps form, are critical for plant adaptation to environmental conditions and maintaining internal homeostasis. By controlling the apoplastic movement of water and ions, these structures are instrumental in plant survival under conditions such as drought, salinity, and nutrient deficiency .

What is the molecular structure and characteristics of the XL3 protein?

The XL3 protein consists of 180 amino acid residues with the sequence: MELSIQKIEALIRLSTIVM LVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLYTSLAAAYNLLQLCCSSFSASYKGTSLQSYAY LAWLRYILDQAVVYAVFAGNLAALEHSFLVLTGEENFQWLKWCNKYTRFCTQIGGSLLCGFVASL LMFSIASISAFNLFRQYSPTKFMHLKL .

XL3 is classified as a membrane protein with multiple transmembrane domains that anchor it in the plasma membrane. The protein belongs to the MARVEL (MAL and related proteins for vesicle trafficking and membrane link) domain-containing family. Its UniProt identification number is Q5K4H9 .

Based on studies of related CASP proteins, XL3 likely contains important extracellular loops (EL1 and EL2) that may be involved in protein-protein interactions and proper localization. Research on Arabidopsis CASP1 indicates that while mutations in specific conserved residues in these loops can affect localization, the loops themselves might be dispensable for proper localization at the Casparian strip domain (CSD) .

The protein is typically stored in a Tris-based buffer with 50% glycerol and should be kept at -20°C for regular storage or -20°C to -80°C for extended preservation. Working aliquots can be maintained at 4°C for up to one week, and repeated freezing and thawing should be avoided to maintain protein integrity .

What are Casparian strips and how does XL3 contribute to their formation?

Casparian strips are specialized cell wall modifications in the root endodermis that form band-like structures around endodermal cells. These structures create an apoplastic diffusion barrier that controls the movement of water and solutes into the vascular system . Composed primarily of lignin, Casparian strips are critical components for maintaining ionic homeostasis and protecting against pathogens and abiotic stresses.

XL3, as a CASP-like protein, contributes to Casparian strip formation through two main mechanisms:

• Formation of a plasma membrane domain: XL3 likely helps create a specialized plasma membrane domain that marks the site where Casparian strips will form. This domain serves as a scaffold for the deposition of lignin .

• Direction of cell wall modification: By interacting with secreted peroxidases, XL3 would mediate the deposition of lignin and the building of Casparian strips. This interaction occurs within the Casparian strip domain .

Studies on CASP proteins have shown that these two activities can be uncoupled - formation of the CASP domain is independent from lignin deposition, and interaction between CASPs and peroxidases can take place outside the Casparian strip domain when CASPs are ectopically expressed .

The precise localization of XL3 at the Casparian strip domain is crucial for its function. This localization creates a defined region where lignin deposition occurs, ensuring that the Casparian strip forms only at the correct position in the endodermal cell wall.

How is the expression of XL3 regulated in cotton plants?

While specific expression data for XL3 across different cotton tissues is limited in the available research, we can infer patterns based on studies of related genes. CASP-like proteins typically show specific expression patterns related to their functions in Casparian strip formation, primarily in root endodermal tissues.

By comparison, other cotton genes show distinct tissue-specific expression patterns:

• GhKCR3 - Transcripts accumulate in rapidly elongating fibers, roots, and stems .

• GhHH3 genes - Preferentially expressed in cotton ovule tissues and regulated by multiple abiotic stresses (cold, heat, salt, drought) and phytohormones (brassinolide, gibberellic acid, indole-3-acetic acid, salicylic acid, and methyl jasmonate) .

• GhCOL3 - Expressed in young leaves, hypocotyls, and flower organs, and exhibits obvious circadian rhythms under long-day conditions .

Given its role in Casparian strip formation, XL3 expression would likely be highest in root tissues, particularly in the endodermis. Its expression might also respond to environmental stresses, as Casparian strips play important roles in stress resistance. The gene's expression could be modulated under conditions such as drought or salinity stress to enhance barrier properties in roots .

Proper regulation of XL3 expression is crucial for normal root development and function. Both spatial and temporal expression patterns would need to be precisely controlled to ensure Casparian strips form at the correct developmental stage and in the appropriate cell types.

How do mutations in the extracellular loops affect the localization and function of CASP-like proteins such as XL3?

Studies on Arabidopsis CASP1 (AtCASP1) provide valuable insights into how mutations in extracellular loops might affect CASP-like proteins such as XL3. Research shows that mutations in the second extracellular loop (EL2) affected protein localization to varying degrees, particularly at residues that are conserved among most CASPL family members .

Specific mutation effects in AtCASP1 included:

• C168S, F174V, and C175S mutations: Caused the protein to persist longer at the lateral plasma membrane, although they still localized to the Casparian strip domain (CSD) at the same time as wild-type protein .

• G158S mutation: Resulted in normal localization at the lateral plasma membrane, but severely delayed localization at the CSD with extremely low signal intensity .

• W164G mutation: Showed the strongest effect, being initially excluded from the CSD and almost undetectable later .

For XL3, similar effects might be expected if corresponding residues were mutated, although the specific impact would depend on the conservation of these residues between AtCASP1 and XL3. The findings suggest that while certain conserved residues in the extracellular loops contribute to proper localization of CASP proteins, the loops themselves are not essential for CSD localization, indicating that other domains, likely the transmembrane regions, play more critical roles in targeting these proteins to their correct subcellular location.

What mechanisms control XL3 localization to the Casparian strip domain?

The precise mechanisms controlling XL3 localization to the Casparian strip domain (CSD) are not fully elucidated, but insights from studies on Arabidopsis CASP proteins suggest several key factors:

• Transmembrane domains: These appear to be essential for CSD localization, as extracellular loop deletions do not prevent localization. The conserved Asp residue in TM3 (corresponding to D134 in AtCASP1) may be particularly important for proper protein folding and localization .

• Protein-protein interactions: CASPs interact with each other to form a platform at the plasma membrane. These interactions likely contribute to their stable localization at the CSD. In Arabidopsis, CASP proteins form homo- and heteromeric complexes .

• Endocytosis regulation: The timing of CASP protein appearance and disappearance at the CSD suggests regulated trafficking to and endocytosis from the plasma membrane. Mutations that affect this process can lead to prolonged persistence at the lateral membrane or delayed CSD localization .

• External guidance cues: In Arabidopsis, the receptor-like kinase SCHENGEN3 (SGN3) helps define the domain where CASPs will localize. Similar signaling proteins may guide XL3 localization in cotton .

• Cytoskeletal interactions: The precise band-like localization pattern may involve interactions with the cytoskeleton, potentially through cytoskeleton-associated proteins.

The proper localization of XL3 is critical for its function in Casparian strip formation. Mislocalization could lead to abnormal Casparian strips, compromising the barrier function of the endodermis and affecting water and nutrient homeostasis in the plant. Understanding these localization mechanisms could provide insights into strategies for modifying root barrier properties to enhance stress resistance in cotton.

How does XL3 interact with the lignin biosynthesis machinery to form Casparian strips?

While specific interactions between XL3 and lignin biosynthesis components in cotton have not been thoroughly characterized, we can infer likely mechanisms based on studies of CASP proteins in other species:

• Peroxidase recruitment: XL3 likely interacts with secreted class III peroxidases that catalyze the polymerization of monolignols into lignin. In Arabidopsis, peroxidases such as PER64 interact with CASP proteins and are essential for Casparian strip lignification .

• Spatial definition of lignification: By forming a precisely defined membrane domain, XL3 would restrict lignin deposition to specific regions of the cell wall, creating the characteristic band-like pattern of Casparian strips .

• NADPH oxidase interaction: CASP proteins may interact with NADPH oxidases that generate reactive oxygen species required for peroxidase-mediated lignin polymerization.

• Monolignol transport: XL3 might facilitate the transport or localized concentration of monolignols (lignin precursors) at the Casparian strip domain.

• Scaffold protein recruitment: XL3 possibly interacts with other proteins that help organize the lignin polymerization machinery, similar to how Arabidopsis CASPs interact with ENHANCED SUBERIN1 (ESB1) .

The interaction between XL3 and lignin biosynthesis machinery is likely bidirectional - XL3 helps position the lignification machinery, while the resulting lignin polymer may help stabilize XL3 in the membrane. This coordination ensures that Casparian strips form with the correct composition and structure to function as effective barriers.

Understanding these interactions could provide opportunities for modifying Casparian strip properties in cotton to enhance stress resistance or nutrient uptake efficiency.

How does XL3 expression respond to various abiotic stresses and phytohormones?

While specific data on XL3 expression under various stresses is not provided in the search results, we can infer potential responses based on studies of other cotton genes and the biological role of Casparian strips:

• Abiotic stress responses: Given that Casparian strips are crucial for stress resistance, XL3 expression might be modulated under abiotic stresses. Similar to histone H3 (HH3) genes in cotton, XL3 expression could be regulated by stresses such as cold, heat, salt (NaCl), and drought (PEG) .

• Phytohormone regulation: XL3 expression might respond to phytohormones similar to other cotton genes. HH3 genes, for instance, are regulated by brassinolide (BL), gibberellic acid (GA), indole-3-acetic acid (IAA), salicylic acid (SA), and methyl jasmonate (MeJA) .

• Stress-specific responses: Different stresses might induce distinct expression patterns. For example:

  • Salt stress: Might increase XL3 expression to enhance Casparian strip formation and reduce ion leakage

  • Drought stress: Could upregulate XL3 to improve water conservation

  • Nutrient stress: Might alter XL3 expression to modify nutrient uptake selectivity

• Tissue-specific regulation: Stress-induced changes in XL3 expression might vary across different root zones or developmental stages, allowing for localized adjustments to barrier properties.

• Temporal dynamics: XL3 expression changes likely follow specific temporal patterns after stress exposure, with potentially different immediate and long-term responses.

Understanding how XL3 responds to environmental conditions could provide insights into cotton's adaptive mechanisms and potentially inform breeding strategies for improved stress tolerance. Research techniques such as qRT-PCR, RNA-seq under various stress conditions, and promoter analysis would be valuable for elucidating these regulatory patterns.

What are the best approaches for isolating and purifying recombinant XL3 protein for experimental studies?

The isolation and purification of recombinant XL3 protein require careful consideration of its membrane protein characteristics. Based on standard practices for recombinant protein production and the available information about XL3, the following approaches are recommended:

Expression System Selection:

Construct Design:

• Tagging strategy: Include a purification tag (His6, GST, MBP) preferably at the C-terminus to avoid interfering with membrane insertion

• Domain expression: Consider expressing just the soluble domains if the full-length protein is difficult to express

• Codon optimization: Adjust for the chosen expression system

• Signal sequence: Include or replace with system-appropriate signals

Purification Protocol:

• Membrane protein extraction: Use appropriate detergents (DDM, LDAO, or OG) for solubilization

• Affinity chromatography: Utilize tag-based purification (Ni-NTA for His-tagged proteins)

• Size exclusion chromatography: Remove aggregates and improve purity

• Storage conditions: Based on the search results, store in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

• Aliquoting: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

Quality Control:

• SDS-PAGE: Verify protein size and purity

• Western blot: Confirm protein identity using tag-specific or XL3-specific antibodies

• Circular dichroism: Assess proper folding, especially important for membrane proteins

• Functional assays: Verify activity through interaction studies with known partners

This approach should be optimized based on specific research goals. For protein-protein interaction studies, maintaining native conformation is critical, while structural studies might require higher purity and stability.

How can researchers effectively study the localization of XL3 in planta?

Studying the in planta localization of XL3 requires multiple complementary approaches to ensure accurate and comprehensive results:

Fluorescent Protein Fusion Approaches:

• Fusion protein construction: Generate XL3-GFP or XL3-mCherry fusion constructs under native or constitutive promoters

• Transformation methods:

  • Stable transformation into cotton via Agrobacterium-mediated methods

  • Transient expression in model systems or cotton seedlings

• Co-localization studies: Express alongside known markers for cellular compartments

• Mutation analysis: Compare wild-type XL3 localization with mutated versions, similar to the approach used for AtCASP1 where mutant protein localization was compared with wild-type AtCASP1-mCherry

• Time-lapse imaging: Track localization changes during development

Advanced Microscopy Techniques:

• Confocal microscopy: Standard approach for cellular localization

• Super-resolution microscopy (STORM, PALM): Provides nanometer-scale resolution

• FRAP (Fluorescence Recovery After Photobleaching): Assess protein mobility and turnover

• BiFC (Bimolecular Fluorescence Complementation): Study protein-protein interactions in vivo

Biochemical and Immunological Methods:

• Subcellular fractionation: Isolate different cellular compartments

• Immunolocalization: Using XL3-specific antibodies

• Proximity labeling: BioID or APEX2 fusion to identify neighboring proteins

Key Considerations:

• Developmental timing: Examine localization at different developmental stages

• Environmental responses: Assess changes under various stress conditions

• Tissue specificity: Focus on root endodermis, but examine other tissues as well

• Control experiments: Include appropriate controls to validate true localization patterns

• Quantitative analysis: Measure fluorescence intensity to assess relative protein abundance

By combining these approaches, researchers can build a comprehensive understanding of XL3 localization patterns and dynamics in cotton plants, providing insights into its function in Casparian strip formation and potentially other cellular processes.

What techniques are most effective for analyzing the role of XL3 in cell wall modification?

Analyzing XL3's role in cell wall modification, particularly in Casparian strip formation, requires a multi-faceted approach combining genetic, biochemical, and microscopic techniques:

Genetic Manipulation Methods:

• Gene silencing: Use virus-induced gene silencing (VIGS) to downregulate XL3 expression, similar to approaches used for other cotton genes

• CRISPR/Cas9 editing: Generate precise mutations in XL3 coding or regulatory regions

• Overexpression studies: Express XL3 under constitutive or inducible promoters

• Domain-specific mutations: Create mutations in key functional domains to separate different roles

Histochemical and Imaging Analysis:

• Lignin visualization:

  • Phloroglucinol-HCl staining for lignified cell walls

  • Basic fuchsin staining for detailed lignin distribution

  • Autofluorescence imaging of lignified structures

• Barrier function assessment:

  • Propidium iodide penetration assays

  • Fluorescent tracer movement analysis

• Electron microscopy:

  • Transmission electron microscopy for ultrastructural analysis

  • Scanning electron microscopy for surface features

• Correlative microscopy: Combine fluorescence and electron microscopy data

Biochemical Analysis:

• Cell wall composition analysis:

  • Fourier-transform infrared spectroscopy (FTIR)

  • Lignin quantification (acetyl bromide method)

  • Monolignol composition via thioacidolysis and GC-MS

• Protein-protein interaction studies:

  • Co-immunoprecipitation with potential partners

  • Yeast two-hybrid screening for interaction partners

  • Pull-down assays with purified proteins

Physiological and Functional Analysis:

• Root hydraulic conductivity measurements

• Ion leakage assays to assess barrier function

• Stress response phenotyping of XL3-modified plants

• Root growth and development assessments

Molecular Analysis:

• Gene expression profiling:

  • RNA-seq to identify genes co-regulated with XL3

  • qRT-PCR for targeted expression analysis

• Chromatin immunoprecipitation (ChIP) to identify transcription factors regulating XL3

• Promoter analysis to identify regulatory elements

By integrating data from these diverse approaches, researchers can build a comprehensive understanding of how XL3 contributes to cell wall modification in cotton roots and potentially in other tissues. This multi-dimensional approach is essential for distinguishing direct effects of XL3 from indirect consequences of altered Casparian strip formation.

How can gene editing technologies be applied to study XL3 function in cotton?

Gene editing technologies, particularly CRISPR/Cas systems, offer powerful approaches to study XL3 function in cotton with unprecedented precision:

Knockout and Knockdown Strategies:

• Complete gene knockout:

  • Design sgRNAs targeting early exons or conserved domains

  • Create frameshift mutations or large deletions

  • Target both A and D subgenome copies in tetraploid cotton

• Conditional knockouts:

  • Use inducible promoters to control Cas9 expression

  • Create tissue-specific knockouts using tissue-specific promoters

• Knockdown approach:

  • Use CRISPR interference (CRISPRi) for transcriptional repression

  • Target promoter or enhancer regions

Precise Mutation Generation:

• Domain-specific mutations:

  • Target conserved residues identified from comparative analyses

  • Create mutations analogous to those studied in Arabidopsis CASP1

  • Test the importance of specific transmembrane domains or extracellular loops

• Base editing:

  • Use cytosine or adenine base editors for precise nucleotide changes

  • Create specific amino acid substitutions without double-strand breaks

• Prime editing:

  • Introduce precise edits, insertions, or deletions without donor DNA

Promoter and Regulatory Element Modification:

• Promoter editing:

  • Modify cis-regulatory elements to alter expression patterns

  • Create inducible expression systems

• Enhancer modification:

  • Identify and edit enhancer elements

  • Test the importance of specific regulatory sequences

Endogenous Tagging:

• Fluorescent protein knock-in:

  • Insert fluorescent protein coding sequences at the XL3 locus

  • Create translational fusions for protein localization studies

• Epitope tagging:

  • Add small epitope tags for antibody detection

  • Enable immunoprecipitation of endogenous protein complexes

Multi-gene Editing:

• Multiplex editing:

  • Target XL3 along with potential interaction partners

  • Create double or triple mutants to assess genetic interactions

• Paralog targeting:

  • Edit multiple members of the CASP family simultaneously

  • Address potential functional redundancy

Implementation Considerations:

• Cotton transformation: Optimize Agrobacterium-mediated transformation protocols

• Genotyping strategies: Develop efficient screening methods for edited plants

• Off-target analysis: Assess potential off-target effects through whole-genome sequencing

• Homoeolog specificity: Design guides specific to A or D subgenome copies