Recombinant Gossypium hirsutum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Process StepDetailsSource
Expression HostE. coli
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol addition recommended for stability
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles

Critical Considerations:

  • Repeated freezing/thawing degrades protein integrity, necessitating aliquoting for long-term use .

  • The inclusion of 6% trehalose in G. barbadense cemA formulations highlights stabilization strategies , though G. hirsutum data specify glycerol .

Research Applications and Tools

ApplicationDetailsSource
ELISA KitsAvailable for immunological detection (e.g., CSB-CF640744GHB)
Stress Response StudiesPotential utility in analyzing chloroplast function under abiotic stress
ProteomicsUsed in mapping chloroplast membrane protein complexes

Challenges:

  • Functional annotations for ~30% of chloroplast envelope proteins remain unknown, including cemA .

  • Structural homology with G. barbadense cemA suggests conserved roles, but species-specific differences require validation .

Research Gaps and Future Directions

  1. Functional Characterization:

    • Investigate cemA’s role in protein import or membrane dynamics using CRISPR-edited mutants.

  2. Membrane Interactions:

    • Co-IP or cryo-EM studies to identify binding partners (e.g., transporters, chaperones).

  3. Comparative Genomics:

    • Phylogenetic analysis of cemA across Gossypium species to trace evolutionary divergence.

References

  1. Creative Biomart. (2025). Recombinant Full Length Gossypium barbadense Chloroplast Envelope Membrane Protein (cemA).

  2. Osborne, A. N. et al. (2023). Gossypium hirsutum gene of unknown function Gohir.A03G0737001.1 encodes a potential chaperone-like protein. MicroPublication Biology.

  3. Froehlich, J. E. et al. (2003). Proteomics of the chloroplast envelope membranes from Arabidopsis. Proceedings of the National Academy of Sciences.

  4. Anagnostics. (n.d.). ELISA Recombinant Gossypium hirsutum Chloroplast envelope membrane protein (cemA).

  5. Osborne, A. N. et al. (2023). Gossypium hirsutum gene of unknown function Gohir.A03G0737001.1: A chaperone-like protein of POR1. PMC.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLLYLASIVFLPWWISLSFNKSLKSWITNWWDTRQSETFLNDIQEKSILEQF IEVEELFLLDEMIKEYPETHLQKLRIGIQKETIQLIKLHNEDHIHTILHFSTNLICFVIL SGYSILGNEELLILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: ghi:3989161

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its fundamental role in cotton chloroplasts?

Chloroplast envelope membrane protein (cemA) is a 34 kDa protein encoded by the chloroplast genome of Gossypium hirsutum. This protein is localized to the chloroplast envelope membrane and is believed to play a role in carbon uptake mechanisms. The cemA gene product was initially characterized as a chloroplast envelope membrane protein of approximately 34 kDa, although subsequent research has refined our understanding of its structure and function .

In terms of genomic organization, cemA is part of a gene cluster in the chloroplast that includes atpA (encoding the α-subunit of coupling-factor-1 ATP synthase), psbI (encoding a small photosystem II polypeptide), and atpH (encoding subunit III of the chloroplast ATP synthase) . Unlike some other genes in this cluster, cemA appears to lack its own promoter, suggesting that its expression depends on polycistronic transcription with neighboring genes.

How is the cemA gene organized in the chloroplast genome and what are its transcriptional characteristics?

The cemA gene in Gossypium hirsutum chloroplast genome is positioned within a polycistronic transcription unit that includes multiple genes. Based on studies of similar systems, the gene cluster arrangement follows the order: atpA, psbI, cemA, and atpH . Unlike the other genes in this cluster, cemA notably lacks its own promoter, which has significant implications for its expression patterns.

Transcriptional analysis reveals that cemA mRNA is present only as part of di-, tri-, or tetracistronic transcripts rather than as a monocistronic transcript . This transcriptional organization suggests that cemA expression is regulated as part of a coordinated expression strategy for multiple chloroplast genes. The absence of a dedicated promoter for cemA indicates that its expression relies on read-through transcription from upstream promoters and subsequent RNA processing.

What are the most effective expression systems for producing recombinant cemA protein?

For recombinant production of Gossypium hirsutum cemA protein, Escherichia coli expression systems have been successfully employed for similar chloroplast proteins . When designing an expression system, researchers should consider the following methodological approaches:

  • Codon optimization: Adapting the cemA coding sequence to E. coli codon usage preferences to enhance expression efficiency.

  • Selection of expression vectors: Using vectors with strong, inducible promoters (such as T7) that allow control over expression timing.

  • Fusion tag strategies: Incorporating purification tags such as His-tag, GST, or MBP to facilitate protein isolation and enhance solubility.

  • Expression conditions optimization: Systematic testing of induction parameters including temperature (typically lowered to 16-20°C to improve proper folding), inducer concentration, and duration of expression.

  • Membrane protein considerations: Using specialized E. coli strains designed for membrane protein expression or incorporating solubilizing fusion partners.

For proteins like cemA with complex membrane integration, alternative expression systems such as cell-free systems or eukaryotic hosts may be considered if bacterial expression yields inadequate results.

What purification strategies yield the highest purity and activity for recombinant cemA?

Purification of recombinant cemA protein requires specialized approaches due to its membrane-associated nature. A robust purification strategy would include:

  • Membrane fraction isolation: Differential centrifugation to separate cell debris, inclusion bodies, and membrane fractions.

  • Detergent solubilization: Careful selection of detergents (such as n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100) at optimized concentrations to extract cemA from membranes while maintaining its native conformation.

  • Affinity chromatography: Utilizing fusion tags (His-tag or other affinity tags) for initial capture of the target protein from the solubilized membrane fraction.

  • Size exclusion chromatography: Further purification based on molecular size to separate the protein from aggregates and other contaminants.

  • Quality assessment: Employing SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and purity.

The storage buffer composition is critical for maintaining protein stability, typically containing Tris-based buffer with 50% glycerol . For extended storage, maintaining the protein at -20°C or -80°C is recommended, with avoidance of repeated freeze-thaw cycles.

How can researchers effectively validate the functional activity of purified recombinant cemA?

Functional validation of recombinant cemA protein requires multiple complementary approaches:

  • Binding assays: If cemA functions in carbon transport, assessing its binding to carbon substrates using isothermal titration calorimetry or surface plasmon resonance.

  • Reconstitution in liposomes: Incorporating purified cemA into artificial membrane systems and measuring carbon uptake rates across the membrane.

  • GTPase/ATPase activity assays: While not directly established for cemA, other chloroplast proteins from Gossypium hirsutum have demonstrated GTPase activity that was Mg²⁺-dependent and affected by Ca²⁺ concentrations . Similar enzymatic assays could be explored for cemA.

  • Complementation studies: Introducing the recombinant cemA into cemA-deficient systems to assess functional restoration.

  • Structural integrity assessment: Using circular dichroism to confirm proper secondary structure formation, particularly for a membrane protein where proper folding is critical for function.

How does cemA fit into the larger context of chloroplast gene expression and regulation?

The expression pattern of cemA raises important questions about chloroplast gene regulation. In Chlamydomonas reinhardtii, studies have shown that cemA is part of a polycistronic transcription unit that generates complex transcript patterns . Unlike the more common monocistronic organization observed in many chloroplast genes, cemA transcripts are found exclusively as components of di-, tri-, or tetracistronic mRNAs.

This transcriptional organization has significant implications for understanding chloroplast gene expression regulation. Research approaches to investigate this aspect include:

  • Transcript mapping: Using Northern blotting, RT-PCR, and RNA-seq to characterize the full complement of cemA-containing transcripts.

  • Promoter analysis: Identifying the transcription start sites using 5′ RACE and characterizing the promoter elements that drive expression of the polycistronic unit.

  • RNA processing studies: Investigating the post-transcriptional processing mechanisms that may generate different transcript forms from the initial polycistronic transcript.

  • Translational regulation analysis: Examining how translation efficiency is maintained despite the polycistronic nature of the transcripts, possibly through internal ribosome entry sites or other mechanisms.

What protein-protein interactions might cemA participate in, and how can these be studied?

As a chloroplast envelope membrane protein, cemA likely participates in protein complexes that facilitate its function in carbon uptake or other processes. To elucidate these interactions, researchers should consider these methodological approaches:

  • Co-immunoprecipitation: Using antibodies against cemA to pull down interacting proteins from solubilized chloroplast membranes, followed by mass spectrometry identification.

  • Yeast two-hybrid membrane system adaptations: Modified Y2H systems designed for membrane proteins to identify potential interacting partners.

  • Bimolecular fluorescence complementation: Split fluorescent protein assays in plant protoplasts to visualize interactions in near-native conditions.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry to identify proteins in close proximity to cemA in the native membrane environment.

  • Blue native PAGE: Gentle solubilization of membranes followed by native gel electrophoresis to preserve and identify intact protein complexes containing cemA.

How can researchers address the technical challenges of studying cemA expression and localization in planta?

Studying cemA in its native context presents several technical challenges that require specialized approaches:

  • Tissue-specific expression analysis: Quantitative RT-PCR or RNA-seq of different cotton tissues to determine expression patterns, similar to the Northern-blot analysis used for annexin gene expression during cotton fiber elongation stages .

  • Immunolocalization: Generation of specific antibodies against cemA for immunofluorescence microscopy to confirm envelope localization.

  • Translational fusions: Creation of cemA-fluorescent protein fusions (with careful consideration of fusion position to maintain functionality) for in vivo localization studies.

  • Chloroplast isolation: Optimized protocols for intact chloroplast isolation from cotton tissues, followed by subfractionation to confirm envelope membrane localization.

  • Temporal expression patterns: Analysis of cemA expression during different developmental stages or in response to environmental stimuli, providing insights into its physiological relevance.

How should researchers interpret contradictory findings regarding cemA function across different plant species?

The function of cemA may vary between different plant species or may be described differently in the literature. When faced with contradictory findings, researchers should:

  • Conduct comparative sequence analysis: Align cemA sequences from multiple species to identify conserved and divergent regions that might explain functional differences.

  • Perform phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary relationships between cemA proteins from different species and correlate this with functional divergence.

  • Design experiments to directly test competing hypotheses: For example, if cemA is suggested to function in carbon uptake in one species but not another, design experiments that specifically measure carbon uptake in both systems under identical conditions.

  • Consider contextual differences: Evaluate experimental conditions, methodologies, and physiological contexts that might explain apparent contradictions in findings.

  • Integrate multiple data types: Combine structural, functional, transcriptomic, and proteomic data to develop a more comprehensive understanding of cemA function.

What bioinformatic approaches are most useful for predicting cemA functional domains and evolutionary relationships?

To comprehensively analyze cemA structure, function, and evolution, researchers should employ the following bioinformatic approaches:

  • Transmembrane domain prediction: Using algorithms such as TMHMM, Phobius, or TOPCONS to identify membrane-spanning regions.

  • Functional domain identification: Employing InterProScan, SMART, or Pfam to identify conserved domains that might suggest functional roles.

  • Structural modeling: Utilizing I-TASSER, AlphaFold, or SWISS-MODEL to predict three-dimensional structure, particularly for soluble domains.

  • Evolutionary analysis: Constructing maximum likelihood or Bayesian phylogenetic trees using sequences from diverse plant species to understand evolutionary relationships.

  • Coevolution analysis: Identifying potentially interacting proteins through correlated evolutionary patterns.

  • Molecular dynamics simulations: Simulating cemA behavior in a membrane environment to understand conformational dynamics related to function.

How might CRISPR/Cas9 technology be applied to study cemA function in Gossypium hirsutum?

While editing the chloroplast genome with CRISPR/Cas9 presents unique challenges compared to nuclear genome editing, several strategic approaches could be employed:

  • Plastid transformation strategies: Developing optimized protocols for delivering CRISPR/Cas9 components to chloroplasts, potentially using biolistic methods similar to those described for chloroplast transformation .

  • Inducible knockout systems: Creating conditional cemA knockout lines to bypass potential lethality of constitutive knockouts.

  • Base editing approaches: Employing precision editing to introduce specific mutations rather than complete gene disruption.

  • Domain-specific modifications: Targeting specific functional domains to create partial loss-of-function variants that could reveal domain-specific functions.

  • Reporter gene fusions: Introducing reporter genes in-frame with cemA to study expression patterns and protein localization without disrupting function.

The results from such genetic manipulations would provide definitive evidence regarding cemA function, complementing biochemical and structural studies of the recombinant protein.

What emerging technologies might advance our understanding of cemA structure-function relationships?

Several cutting-edge technologies show promise for deepening our understanding of cemA:

  • Cryo-electron microscopy: For high-resolution structural determination of cemA in its membrane environment, potentially revealing conformational states related to function.

  • Single-molecule imaging techniques: To visualize cemA dynamics in membranes and potentially capture conformational changes during activity.

  • Native mass spectrometry: For analyzing intact membrane protein complexes containing cemA, providing insights into stoichiometry and stability.

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions of structural flexibility and potential substrate binding sites.

  • Advanced computational methods: Using machine learning approaches to predict protein-protein interactions and functional sites based on sequence and structural features.

  • Integrative structural biology: Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, cryo-EM) with computational modeling to generate comprehensive structural models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.