Recombinant Gossypium hirsutum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Gossypium hirsutum Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Gossypium hirsutum Cytochrome b6-f complex subunit 4 (petD) is a protein expressed in E. coli and tagged with N-terminal Histidine . It is derived from Gossypium hirsutum, also known as upland cotton . Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex, which is essential for photosynthetic electron transfer in plants .

  • Synonyms The petD protein is also known as Cytochrome b6-f complex subunit 4 and 17 kDa polypeptide .

  • Source Organism The protein is derived from Gossypium hirsutum .

  • Expression Host E. coli

Structure and Properties

The recombinant protein consists of the full-length Gossypium hirsutum Cytochrome b6-f complex subunit 4 (petD) protein, which includes amino acids 1 to 160 . It is fused to an N-terminal His tag to facilitate purification .

  • Length Full Length (1-160 aa)

  • Molecular Weight The calculated molecular mass of GhCYP-3 is 18.2 kDa .

  • Amino Acid Sequence The amino acid sequence of the recombinant protein is: MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF .

  • Purity Greater than 90% as determined by SDS-PAGE .

  • Form Lyophilized powder .

Production and Purification

The recombinant protein is produced in E. coli and purified using affinity chromatography due to the His tag .

  • Expression The protein is expressed in E. coli .

  • Purification Tag The protein is fused to an N-terminal His tag .

  • Purification Method Affinity chromatography.

Function and Significance

Cytochrome b6-f complex subunit 4 (petD) is an essential component of the cytochrome b6-f complex, which plays a crucial role in photosynthetic electron transfer .

  • Photosynthesis The cytochrome b6-f complex mediates electron transfer between Photosystem II and Photosystem I in the thylakoid membrane of chloroplasts .

  • Electron Transfer The petD subunit is vital for the assembly and function of the cytochrome b6-f complex .

  • Plant Development Proper function of the cytochrome b6-f complex is essential for plant growth and development .

Cyclophilins in Gossypium hirsutum

Cyclophilins (CYPs) are peptidyl prolyl cis/trans isomerases (PPIases) that play roles in plant responses to biotic and abiotic stresses .

  • GhCYP-3 A cyclophilin gene in Gossypium hirsutum . Recombinant GhCYP-3 displayed inhibitory effects on V. dahliae .

  • PPIase Activity GhCYP-3 contains conserved amino acid residues and has PPIase activity .

  • Multi-Domain CYPs 14 GhCYPs are multi-domain proteins, containing domains such as RRM, zf-CCHC, WD40, and TPR .

Applications and Research

The recombinant protein is used in various research applications .

  • Biochemical Assays Studying protein-protein interactions .

  • Structural Studies Determining the three-dimensional structure of the protein .

  • Functional Analysis Investigating the role of Cytochrome b6-f complex subunit 4 (petD) in photosynthesis and plant development .

Verticillium dahliae Resistance

GhCYP-3 is involved in the resistance of cotton to V. dahliae infection, potentially through antifungal activity .

  • Inhibitory Effects Recombinant GhCYP-3 exhibited inhibitory effects on V. dahliae on the plate .

  • Antifungal Activity Extracts from GhCYP-3 transgenic Arabidopsis displayed significant inhibitory activity to conidia germinating and hyphal growth of V. dahliae .

Data Table: Properties of Recombinant Gossypium hirsutum Cytochrome b6-f Complex Subunit 4 (petD)

PropertyDescription
Cat.No.RFL27261GF
SpeciesGossypium hirsutum
SourceE. coli
TagHis
Protein LengthFull Length (1-160)
FormLyophilized powder
AA SequenceMGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended.
Gene NamepetD
SynonymspetD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
UniProt IDQ2L939

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: ghi:3989135

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of petD in the Cytochrome b6-f complex in cotton photosynthesis?

The petD gene encodes subunit 4 of the Cytochrome b6-f complex, which serves as an essential intermediary in the electron transport chain between Photosystem II and Photosystem I. This complex is critical for photosynthetic efficiency and plant energy metabolism. In Gossypium species, as in other plants, proper assembly and function of this complex directly impacts photosynthetic capacity and subsequently affects plant growth and development .

Methodologically, researchers investigating petD function typically employ knockout/knockdown approaches coupled with photosynthetic efficiency measurements to establish causative relationships between petD expression and plant performance.

What expression systems are most effective for producing recombinant G. hirsutum petD protein?

Based on successful expression of G. barbadense petD, Escherichia coli represents a viable heterologous expression system for recombinant petD proteins . When expressing G. hirsutum petD, researchers should consider the following methodological factors:

  • Codon optimization for E. coli expression

  • Selection of appropriate fusion tags (His-tag has been successfully used)

  • Optimization of induction parameters (temperature, IPTG concentration, duration)

  • Inclusion of protease inhibitors during extraction

The expression construct design should account for the membrane-associated nature of this protein, potentially employing solubilization strategies or specialized E. coli strains designed for membrane protein expression.

What purification protocols yield the highest purity and activity for recombinant petD protein?

For His-tagged recombinant petD proteins, a multi-step purification strategy is recommended:

  • Initial purification via immobilized metal affinity chromatography (IMAC)

  • Secondary purification using size exclusion chromatography

  • Quality assessment via SDS-PAGE (target purity >90%)

Methodologically, researchers should monitor protein yield and purity at each step, while maintaining conditions that preserve native structure. For membrane-associated proteins like petD, inclusion of appropriate detergents throughout the purification process is critical.

What storage conditions maintain stability of purified recombinant petD protein?

Based on protocols for similar recombinant proteins:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Long-term storage: -20°C to -80°C as aliquots with 5-50% glycerol

  • Lyophilization in Tris/PBS-based buffer with 6% trehalose (pH 8.0)

To methodically assess stability, researchers should perform activity assays after various storage durations and conditions, establishing a stability profile specific to the G. hirsutum protein.

How can researchers assess the role of petD in cytochrome b6-f complex assembly?

To investigate petD's role in complex assembly, several methodological approaches are effective:

  • In vivo radiolabeling with 35S-Met followed by blue native/SDS-PAGE (BN-SDS-PAGE) to visualize complex assembly stages

  • Sucrose gradient ultracentrifugation to separate assembled complexes from free proteins

  • Co-immunoprecipitation with antibodies against other complex components

These techniques have successfully demonstrated that low-molecular-weight subunits (like PetG and PetN) are essential for proper assembly of the Cyt b6-f complex . Similar approaches would be valuable for assessing petD's role in G. hirsutum.

What techniques best distinguish between monomeric and dimeric forms of the cytochrome b6-f complex?

Blue Native gel electrophoresis (BN-PAGE) represents the gold standard for analyzing oligomeric states of membrane protein complexes. Research on cytochrome b6-f complex has shown that:

  • BN-SDS-PAGE effectively separates monomeric and dimeric forms

  • In wild-type plants, the dimeric form predominates under normal conditions

  • In mutants lacking certain subunits, the balance shifts toward monomeric forms

Methodologically, researchers should couple BN-PAGE with western blotting using antibodies against various complex components to confirm the presence of petD in different oligomeric states.

What experimental approaches can resolve conflicting data regarding petD function between different cotton species?

To methodically address potential conflicts in research findings between G. hirsutum and other cotton species:

  • Perform parallel expression studies using identical experimental conditions

  • Develop species-specific antibodies to accurately quantify native protein levels

  • Create reciprocal complementation lines (e.g., G. hirsutum petD expressed in G. barbadense knockout background)

  • Couple structural studies with functional assays to correlate sequence differences with functional variations

This multi-faceted approach would help determine whether observed functional differences represent true biological diversity or are artifacts of different experimental methodologies.

How does the interaction between petD and other subunits contribute to complex stability?

The following table summarizes key information about cytochrome b6-f complex subunits and their contributions to complex assembly:

SubunitImpact of Deletion on Complex AssemblyLocation in ComplexInteraction Partners
petD (Subunit IV)Likely essential (by inference)Membrane-spanningCyt b6, Rieske FeS
PetL~50% reduction in complexPeripheralStabilizes Rieske FeS protein
PetGEssential, complex undetectablePeripheralMultiple subunits
PetNEssential, complex undetectablePeripheralMultiple subunits

Data compiled from search result

Methodologically, researchers investigating these interactions should employ a combination of co-immunoprecipitation, crosslinking studies, and structural biology approaches to map the precise interaction interfaces between petD and other subunits.

How can genomic approaches enhance our understanding of petD evolution and function in Gossypium species?

The complex allotetraploid genome of G. hirsutum presents both challenges and opportunities for understanding petD evolution. Methodological approaches should include:

  • Comparative genomic analysis across the A and D subgenomes of G. hirsutum

  • Assessment of selection pressure on petD through Ka/Ks ratio analysis

  • Identification of regulatory elements controlling petD expression

  • Integration with genome-wide association studies (GWAS) to link petD variation with phenotypic traits

These approaches would place petD function within the broader context of cotton evolution and domestication, potentially revealing selection pressures that have shaped cytochrome b6-f complex function in modern cotton varieties.

What emerging technologies hold promise for deeper investigation of petD function?

Several cutting-edge methodological approaches could advance understanding of petD function:

  • CRISPR-Cas9 genome editing to create precise modifications in the petD gene

  • Single-molecule imaging techniques to visualize complex assembly dynamics in real-time

  • Cryo-EM structural studies of G. hirsutum-specific cytochrome b6-f complex

  • Multi-omics integration (transcriptomics, proteomics, metabolomics) to assess systemic effects of petD modifications

These approaches would overcome limitations of traditional genetic and biochemical methods, providing unprecedented resolution of petD function within the complex photosynthetic machinery of cotton.

How might genetic engineering of petD contribute to improved cotton photosynthetic efficiency?

Based on our understanding of the critical role of cytochrome b6-f complex in photosynthesis, targeted engineering of petD could potentially enhance cotton productivity through:

  • Optimization of electron transport chain efficiency

  • Increased stability of the complex under stress conditions

  • Modified regulatory properties affecting state transitions

A methodological framework for this research would include:

  • Structure-guided design of modified petD variants

  • Transgenic expression in cotton using appropriate promoters

  • Comprehensive phenotyping under controlled and field conditions

  • Integration with breeding programs to incorporate beneficial variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.