Recombinant Gossypium hirsutum Cytochrome b6-f complex subunit 4 (petD) is a protein expressed in E. coli and tagged with N-terminal Histidine . It is derived from Gossypium hirsutum, also known as upland cotton . Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex, which is essential for photosynthetic electron transfer in plants .
Synonyms The petD protein is also known as Cytochrome b6-f complex subunit 4 and 17 kDa polypeptide .
Source Organism The protein is derived from Gossypium hirsutum .
The recombinant protein consists of the full-length Gossypium hirsutum Cytochrome b6-f complex subunit 4 (petD) protein, which includes amino acids 1 to 160 . It is fused to an N-terminal His tag to facilitate purification .
Molecular Weight The calculated molecular mass of GhCYP-3 is 18.2 kDa .
Amino Acid Sequence The amino acid sequence of the recombinant protein is: MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF .
The recombinant protein is produced in E. coli and purified using affinity chromatography due to the His tag .
Purification Tag The protein is fused to an N-terminal His tag .
Purification Method Affinity chromatography.
Cytochrome b6-f complex subunit 4 (petD) is an essential component of the cytochrome b6-f complex, which plays a crucial role in photosynthetic electron transfer .
Photosynthesis The cytochrome b6-f complex mediates electron transfer between Photosystem II and Photosystem I in the thylakoid membrane of chloroplasts .
Electron Transfer The petD subunit is vital for the assembly and function of the cytochrome b6-f complex .
Plant Development Proper function of the cytochrome b6-f complex is essential for plant growth and development .
Cyclophilins (CYPs) are peptidyl prolyl cis/trans isomerases (PPIases) that play roles in plant responses to biotic and abiotic stresses .
GhCYP-3 A cyclophilin gene in Gossypium hirsutum . Recombinant GhCYP-3 displayed inhibitory effects on V. dahliae .
PPIase Activity GhCYP-3 contains conserved amino acid residues and has PPIase activity .
Multi-Domain CYPs 14 GhCYPs are multi-domain proteins, containing domains such as RRM, zf-CCHC, WD40, and TPR .
The recombinant protein is used in various research applications .
Structural Studies Determining the three-dimensional structure of the protein .
Functional Analysis Investigating the role of Cytochrome b6-f complex subunit 4 (petD) in photosynthesis and plant development .
GhCYP-3 is involved in the resistance of cotton to V. dahliae infection, potentially through antifungal activity .
Inhibitory Effects Recombinant GhCYP-3 exhibited inhibitory effects on V. dahliae on the plate .
Antifungal Activity Extracts from GhCYP-3 transgenic Arabidopsis displayed significant inhibitory activity to conidia germinating and hyphal growth of V. dahliae .
| Property | Description |
|---|---|
| Cat.No. | RFL27261GF |
| Species | Gossypium hirsutum |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-160) |
| Form | Lyophilized powder |
| AA Sequence | MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuge prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. |
| Gene Name | petD |
| Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
| UniProt ID | Q2L939 |
KEGG: ghi:3989135
The petD gene encodes subunit 4 of the Cytochrome b6-f complex, which serves as an essential intermediary in the electron transport chain between Photosystem II and Photosystem I. This complex is critical for photosynthetic efficiency and plant energy metabolism. In Gossypium species, as in other plants, proper assembly and function of this complex directly impacts photosynthetic capacity and subsequently affects plant growth and development .
Methodologically, researchers investigating petD function typically employ knockout/knockdown approaches coupled with photosynthetic efficiency measurements to establish causative relationships between petD expression and plant performance.
Based on successful expression of G. barbadense petD, Escherichia coli represents a viable heterologous expression system for recombinant petD proteins . When expressing G. hirsutum petD, researchers should consider the following methodological factors:
Codon optimization for E. coli expression
Selection of appropriate fusion tags (His-tag has been successfully used)
Optimization of induction parameters (temperature, IPTG concentration, duration)
Inclusion of protease inhibitors during extraction
The expression construct design should account for the membrane-associated nature of this protein, potentially employing solubilization strategies or specialized E. coli strains designed for membrane protein expression.
For His-tagged recombinant petD proteins, a multi-step purification strategy is recommended:
Initial purification via immobilized metal affinity chromatography (IMAC)
Secondary purification using size exclusion chromatography
Methodologically, researchers should monitor protein yield and purity at each step, while maintaining conditions that preserve native structure. For membrane-associated proteins like petD, inclusion of appropriate detergents throughout the purification process is critical.
Based on protocols for similar recombinant proteins:
Short-term storage (up to one week): 4°C in appropriate buffer
Long-term storage: -20°C to -80°C as aliquots with 5-50% glycerol
Lyophilization in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
To methodically assess stability, researchers should perform activity assays after various storage durations and conditions, establishing a stability profile specific to the G. hirsutum protein.
To investigate petD's role in complex assembly, several methodological approaches are effective:
In vivo radiolabeling with 35S-Met followed by blue native/SDS-PAGE (BN-SDS-PAGE) to visualize complex assembly stages
Sucrose gradient ultracentrifugation to separate assembled complexes from free proteins
Co-immunoprecipitation with antibodies against other complex components
These techniques have successfully demonstrated that low-molecular-weight subunits (like PetG and PetN) are essential for proper assembly of the Cyt b6-f complex . Similar approaches would be valuable for assessing petD's role in G. hirsutum.
Blue Native gel electrophoresis (BN-PAGE) represents the gold standard for analyzing oligomeric states of membrane protein complexes. Research on cytochrome b6-f complex has shown that:
BN-SDS-PAGE effectively separates monomeric and dimeric forms
In wild-type plants, the dimeric form predominates under normal conditions
In mutants lacking certain subunits, the balance shifts toward monomeric forms
Methodologically, researchers should couple BN-PAGE with western blotting using antibodies against various complex components to confirm the presence of petD in different oligomeric states.
To methodically address potential conflicts in research findings between G. hirsutum and other cotton species:
Perform parallel expression studies using identical experimental conditions
Develop species-specific antibodies to accurately quantify native protein levels
Create reciprocal complementation lines (e.g., G. hirsutum petD expressed in G. barbadense knockout background)
Couple structural studies with functional assays to correlate sequence differences with functional variations
This multi-faceted approach would help determine whether observed functional differences represent true biological diversity or are artifacts of different experimental methodologies.
The following table summarizes key information about cytochrome b6-f complex subunits and their contributions to complex assembly:
| Subunit | Impact of Deletion on Complex Assembly | Location in Complex | Interaction Partners |
|---|---|---|---|
| petD (Subunit IV) | Likely essential (by inference) | Membrane-spanning | Cyt b6, Rieske FeS |
| PetL | ~50% reduction in complex | Peripheral | Stabilizes Rieske FeS protein |
| PetG | Essential, complex undetectable | Peripheral | Multiple subunits |
| PetN | Essential, complex undetectable | Peripheral | Multiple subunits |
Data compiled from search result
Methodologically, researchers investigating these interactions should employ a combination of co-immunoprecipitation, crosslinking studies, and structural biology approaches to map the precise interaction interfaces between petD and other subunits.
The complex allotetraploid genome of G. hirsutum presents both challenges and opportunities for understanding petD evolution. Methodological approaches should include:
Comparative genomic analysis across the A and D subgenomes of G. hirsutum
Assessment of selection pressure on petD through Ka/Ks ratio analysis
Identification of regulatory elements controlling petD expression
Integration with genome-wide association studies (GWAS) to link petD variation with phenotypic traits
These approaches would place petD function within the broader context of cotton evolution and domestication, potentially revealing selection pressures that have shaped cytochrome b6-f complex function in modern cotton varieties.
Several cutting-edge methodological approaches could advance understanding of petD function:
CRISPR-Cas9 genome editing to create precise modifications in the petD gene
Single-molecule imaging techniques to visualize complex assembly dynamics in real-time
Cryo-EM structural studies of G. hirsutum-specific cytochrome b6-f complex
Multi-omics integration (transcriptomics, proteomics, metabolomics) to assess systemic effects of petD modifications
These approaches would overcome limitations of traditional genetic and biochemical methods, providing unprecedented resolution of petD function within the complex photosynthetic machinery of cotton.
Based on our understanding of the critical role of cytochrome b6-f complex in photosynthesis, targeted engineering of petD could potentially enhance cotton productivity through:
Optimization of electron transport chain efficiency
Increased stability of the complex under stress conditions
Modified regulatory properties affecting state transitions
A methodological framework for this research would include:
Structure-guided design of modified petD variants
Transgenic expression in cotton using appropriate promoters
Comprehensive phenotyping under controlled and field conditions
Integration with breeding programs to incorporate beneficial variants