Recombinant Gossypium hirsutum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Cytochrome b6 (petB) Functional Role

Cytochrome b6, encoded by the petB gene, is a core subunit of the cytochrome b6-f complex – an essential component of photosynthetic electron transport chains . This complex facilitates:

  • Plastoquinol oxidation

  • Plastocyanin reduction

  • Proton gradient generation for ATP synthesis

In Gossypium hirsutum (cotton), cytochrome b6-f complex subunits are nuclear/chloroplast-encoded, though recombinant petB protein data remains unspecified in current sources.

Recombinant Cytochrome b6 Production Systems

While Gossypium-specific petB recombinant data is unavailable, cross-species production strategies provide actionable insights:

Table 1: Recombinant Cytochrome b6 Expression Platforms

Host SystemAdvantagesExample ApplicationsSource
E. coliHigh yield, cost-effectiveStructural studies, antibody production
YeastEukaryotic folding, moderate yieldFunctional assays, kinetic studies
Mammalian cellsPost-translational modificationsEnzyme activity validation

Key parameters for recombinant petB:

  • Purity: ≥85% (SDS-PAGE verified)

  • Storage: Lyophilized at -80°C with 50% glycerol

  • Reconstitution: Tris/PBS buffers (pH 8.0)

Table 2: Conserved Domains in Cytochrome b6 Proteins

SpeciesHemesTransmembrane HelicesKey Functional Residues
Prochlorothrix hollandica34His84, His183, His230
Oryza nivara (Wild Rice)34His82, His181, His228

The recombinant petB structure from Prochlorothrix hollandica (222 aa) contains four transmembrane helices and three heme-binding histidines critical for electron transfer .

Validation Methods for Recombinant Proteins

Standard quality assessments include:

  • Activity assays: NADPH-dependent cytochrome c reduction (e.g., 2.14 μmol/min/mg activity in SdCPR systems)

  • Immunodetection: Polyclonal antibodies targeting N-terminal epitopes (e.g., AS18 4169 for Arabidopsis petB)

  • Stability tests: BN-PAGE analysis of complex integrity

Gossypium-Specific Cytochrome Complex Data

Available Gossypium hirsutum recombinant data focuses on petL (subunit 6), not petB:

  • Expression: Mammalian/yeast systems

  • Purity: >85% (SDS-PAGE)

  • Storage: 12-month stability at -80°C in lyophilized form

No peer-reviewed studies directly addressing Gossypium petB recombinant production were identified in the provided sources.

Critical Research Gaps

  1. Absence of Gossypium petB sequence data in UniProt/GenBank entries cited

  2. No kinetic parameters (Km, Vmax) reported for cotton cytochrome b6 homologs

  3. Limited structural data for dicotyledonous plant cytochrome b6-f complexes

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLGVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: ghi:3989134

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 and what role does it play in cotton chloroplasts?

Cytochrome b6, encoded by the petB gene, is a critical component of the multi-subunit cytochrome b6/f complex in the photosynthetic electron transport chain of cotton and other plants. This complex catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis. The cytochrome b6/f complex consists of four major subunits: cytochrome f (petA gene product), cytochrome b6 (petB gene product), subunit IV (petD gene product), and the Rieske/Iron/sulfur protein (petC gene product) . In cotton specifically, the b6 subunit is embedded in the thylakoid membrane and functions as a crucial electron carrier in the photosynthetic process.

How is the petB gene organized in Gossypium hirsutum chloroplast DNA?

The petB gene in Gossypium hirsutum is located in the chloroplast genome. Unlike many prokaryotic homologs, the cotton petB gene contains introns that must be processed during RNA maturation. RNA editing plays a significant role in the expression of functional petB transcripts in cotton. Notably, editing at position petB-160 has considerable impact on the transmembrane structure of the protein, affecting how amino acid segments are positioned relative to the thylakoid membrane .

What is the membrane topology of Cytochrome b6 in thylakoid membranes?

Cytochrome b6 in cotton, as in other plants, exhibits a specific orientation in the thylakoid membrane with both NH2 and COOH termini positioned on the stromal side of the membrane. Research using trypsin susceptibility assays indicates that cytochrome b6 has an even number of membrane-spanning helices, likely following a 4-helix model. The 214-residue polypeptide has exposed epitopes at positions Asp-5 to Gln-14 (NH2 terminus) and Ile-205 to Leu-214 (COOH terminus) that are accessible from the stromal side .

How does RNA editing affect petB expression in Gossypium hirsutum?

RNA editing is a critical post-transcriptional modification process in cotton chloroplasts that affects petB expression. In Gossypium hirsutum, editing at position petB-160 significantly impacts the transmembrane structure of cytochrome b6. This editing event causes amino acids from positions 1-49, 127-135, and 226-235 to reverse orientation from outside to inside the thylakoid membrane, while amino acids at positions 73-103 and 159-202 shift from inside to outside . Additionally, petB-24 represents a silent editing site that does not change the amino acid type but may affect other aspects of RNA processing or translation.

What factors regulate petB transcript stability in cotton?

While the search results don't provide specific information about petB transcript stability regulation in cotton, research in other plants like Arabidopsis thaliana shows that proteins such as PrfB3 (a plastid ribosomal release factor-like protein) are essential for binding and environment-dependent stabilization of petB RNA. This regulation is crucial for controlling cytochrome b6/f complex levels in response to environmental conditions and stress . Similar mechanisms likely operate in cotton, where transcript stability would be essential for proper cytochrome b6/f complex formation and function.

How does petB RNA editing affect protein secondary structure in Gossypium hirsutum?

RNA editing of petB transcripts in cotton chloroplasts has been shown to affect the protein's secondary structure. Specifically, editing at position petB-160 leads to significant changes in transmembrane domains and can affect the formation of secondary structures around the editing site . More than half of RNA editing sites in cotton chloroplast transcripts, including some in petB, tend to form new α-helix structures in regions upstream and downstream of the edited codon, suggesting RNA editing plays a crucial role in determining protein structure and functionality.

What antibodies are available for detecting Gossypium hirsutum Cytochrome b6 in experimental settings?

While there are no cotton-specific antibodies mentioned in the search results, researchers can utilize antibodies against conserved regions of cytochrome b6. For example, the polyclonal antibody AS18 4169 was raised against a KLH-conjugated peptide from Arabidopsis thaliana PetB protein sequence. This antibody has demonstrated reactivity with cytochrome b6 from multiple plant species including Arabidopsis thaliana, Chlamydomonas reinhardtii, Zea mays, and Pisum sativum . Given the conserved nature of cytochrome b6 across plant species, this antibody may cross-react with the Gossypium hirsutum protein and could be validated for cotton research applications.

What methods are effective for isolating intact thylakoid membranes containing Cytochrome b6 from cotton leaves?

Based on protocols used for other plant species, an effective method for isolating thylakoid membranes containing cytochrome b6 from cotton would likely involve tissue homogenization in a buffer containing 0.4 M sorbitol, 50 mM Hepes-NaOH (pH 7.8), 10 mM NaCl, 5 mM MgCl2, and 2 mM EDTA . This approach preserves membrane integrity while allowing for subsequent protein analysis. After isolation, membrane fractions can be separated by differential centrifugation, and the presence of cytochrome b6 can be confirmed using immunoblotting techniques with appropriate antibodies.

What expression systems are most suitable for producing recombinant Gossypium hirsutum Cytochrome b6?

Though not explicitly mentioned in the search results, the production of functional recombinant cytochrome b6 poses significant challenges due to its membrane-bound nature and the presence of multiple transmembrane domains. Based on research practices with similar proteins, bacterial expression systems (e.g., E. coli) modified to facilitate membrane protein expression or eukaryotic expression systems such as yeast or insect cells might be suitable. Co-expression with chaperone proteins or expression as fusion proteins with solubility-enhancing tags might improve yield and functionality of recombinant cotton cytochrome b6.

How does the transmembrane topology of Cytochrome b6 differ between cotton and other plant species?

The transmembrane topology of cytochrome b6 appears relatively conserved across plant species, with the protein typically containing an even number of membrane-spanning helices. In cotton, RNA editing at position petB-160 causes significant changes in transmembrane organization, with amino acids at positions 1-49, 127-135, and 226-235 reversing from outside to inside the thylakoid membrane, while amino acids at positions 73-103 and 159-202 shift from inside to outside . This specific pattern of transmembrane organization following RNA editing may represent species-specific adaptations in cotton compared to other plants, although comparative data across multiple species would be needed to confirm this hypothesis.

What specific amino acid residues are essential for electron transport function in cotton Cytochrome b6?

While the search results do not provide specific information about essential amino acid residues in cotton cytochrome b6, research in other species suggests that conserved histidine residues coordinating heme groups are critical for electron transport function. The cytochrome b6 protein in the b6/f complex typically contains three heme groups essential for electron transport . In cotton, as in other plants, RNA editing events may play a crucial role in ensuring these functional residues are correctly specified in the mature protein. Detailed mutational analysis or structural studies specific to cotton cytochrome b6 would be needed to identify the precise residues essential for its function.

How does environmental stress affect petB expression and Cytochrome b6 accumulation in cotton?

Environmental stress appears to modulate petB expression and cytochrome b6 accumulation through regulation of RNA stability. While specific information for cotton is not provided in the search results, research in Arabidopsis indicates that proteins like PrfB3 are involved in environment-dependent and stress-mediated regulation of petB transcript stability . This mechanism likely ensures appropriate levels of cytochrome b6/f complex under varying environmental conditions. In cotton, which faces diverse environmental stresses in agricultural settings, similar regulatory mechanisms probably exist to modulate cytochrome b6 levels in response to changing conditions.

What role does Cytochrome b6 play in cotton's adaptation to different light conditions?

As a component of the cytochrome b6/f complex, cotton cytochrome b6 likely plays a crucial role in adapting photosynthetic electron transport to varying light conditions. The cytochrome b6/f complex functions as an intermediate between the light-dependent reactions of photosystems I and II, helping to regulate electron flow based on light availability. While the search results don't provide cotton-specific information regarding light adaptation, research in other plants suggests that modulation of cytochrome b6/f complex levels, potentially through regulation of petB transcript stability, represents an important mechanism for photosynthetic acclimation to different light regimes.

How does RNA editing of petB transcripts in cotton compare to editing patterns in other plant species?

RNA editing patterns in chloroplast transcripts, including petB, show both conservation and diversity across plant species. The table below summarizes RNA editing across various plant species:

SpeciesAbbreviationCommon RNA Editing Events
Gossypium hirsutumGohiHigher number of Ser→Leu edits (30)
Nicotiana tabacumNita21 Ser→Leu edits
Arabidopsis thalianaArth16 Ser→Leu edits
Zea maysZema15 Ser→Leu edits
Oryza sativaOrsa14 Ser→Leu edits

Cotton (Gossypium hirsutum) shows a notably higher number of Ser→Leu editing events compared to other species. Specifically for petB, the editing at position petB-160 in cotton has significant effects on transmembrane structure organization, while petB-24 represents a silent editing site that doesn't change the amino acid type .

What evolutionary insights can be gained from studying Cytochrome b6 sequence conservation across plant lineages?

While the search results don't directly address evolutionary aspects of cytochrome b6, the conservation of this protein across diverse plant species reflects its fundamental importance in photosynthesis. The presence of RNA editing mechanisms affecting petB transcripts in multiple plant lineages suggests that these post-transcriptional modifications represent ancient regulatory mechanisms that have been maintained throughout plant evolution. In cotton, the specific pattern of RNA editing at sites like petB-160 may reflect lineage-specific adaptations that optimize cytochrome b6 function within the specific cellular and environmental context of cotton plants.

What are the main challenges in expressing recombinant cotton Cytochrome b6 and how can they be overcome?

Expressing recombinant cytochrome b6 from cotton likely presents several challenges common to membrane proteins. These include poor expression levels, improper folding, aggregation, and difficulties in purification while maintaining native conformation and function. To overcome these challenges, researchers might consider:

  • Using specialized expression systems designed for membrane proteins

  • Optimizing codon usage for the expression host

  • Employing fusion tags that enhance solubility while allowing proper folding

  • Expressing the protein in a cell-free system in the presence of lipids or detergents

  • Co-expressing with chaperone proteins to aid proper folding

Additionally, researchers should consider the impact of RNA editing on the functional protein sequence, potentially using a gene construct that already incorporates the amino acid changes that would result from RNA editing in vivo.

How can researchers accurately detect and quantify Cytochrome b6 in cotton tissue samples?

For accurate detection and quantification of cytochrome b6 in cotton tissue samples, western blotting using antibodies against conserved epitopes represents an effective approach. The polyclonal antibody AS18 4169, though developed against Arabidopsis thaliana PetB protein, may cross-react with cotton cytochrome b6 due to sequence conservation . For western blotting protocol:

  • Extract thylakoid membranes using a buffer containing 0.4 M sorbitol, 50 mM Hepes-NaOH (pH 7.8), 10 mM NaCl, 5 mM MgCl2, and 2 mM EDTA

  • Denature samples with Laemmli buffer at 75°C for 5 minutes

  • Separate proteins by 12% SDS-PAGE

  • Transfer to PVDF membrane using wet transfer

  • Block with 5% milk for 2 hours at room temperature

  • Incubate with primary antibody at 1:1000 dilution overnight at 4°C

  • Wash and incubate with secondary antibody (anti-rabbit IgG HRP conjugated)

  • Develop using chemiluminescence detection

The expected molecular weight of cytochrome b6 is approximately 24 kDa .

What emerging technologies could advance our understanding of Cytochrome b6 function in cotton?

Several emerging technologies could significantly advance our understanding of cytochrome b6 function in cotton:

  • CRISPR/Cas9 genome editing of the cotton chloroplast genome to introduce specific mutations in the petB gene

  • Cryo-electron microscopy to determine the high-resolution structure of cotton cytochrome b6/f complex

  • Advanced mass spectrometry techniques to characterize post-translational modifications

  • Single-molecule imaging to study the dynamics of cytochrome b6 within the thylakoid membrane

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data to understand cytochrome b6 function in the broader context of cotton photosynthesis

These technologies could provide unprecedented insights into the structure, function, and regulation of cytochrome b6 in cotton and its role in photosynthetic efficiency.

How might engineering of Cytochrome b6 contribute to improving photosynthetic efficiency in cotton?

Engineering cytochrome b6 could potentially improve photosynthetic efficiency in cotton through several approaches:

  • Optimizing the amino acid sequence to enhance electron transport rates

  • Modifying regulatory elements controlling petB expression to increase cytochrome b6/f complex abundance

  • Engineering RNA editing sites to ensure more efficient processing of petB transcripts

  • Altering the transmembrane topology to optimize interaction with other components of the electron transport chain

  • Introducing modifications that improve stability under stress conditions

Such engineering approaches could lead to cotton varieties with enhanced photosynthetic capacity, potentially resulting in improved yield and stress tolerance in agricultural settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.