Recombinant Gossypium hirsutum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Context

ndhE belongs to the NQO superfamily, which includes bacterial azoreductases and eukaryotic quinone reductases. Structural alignments with Pseudomonas aeruginosa azoreductases reveal conserved FMN-binding motifs, underscoring evolutionary conservation of redox-active domains .

Experimental Use

The recombinant ndhE is used to study:

  • Photosynthetic Electron Transport: Role in cyclic electron flow and ROS mitigation.

  • Stress Responses: Interaction with chloroplast redox networks under oxidative stress.

  • Structural Biology: Crystallization for X-ray diffraction studies (facilitated by His-tag) .

Key Research Findings

  1. RNA Editing Dependency:

    • ndhE codon 78 editing (A→E) is critical for proper NDH complex assembly, as unedited residues disrupt secondary structure .

    • Editing efficiency varies among plant species, with G. hirsutum showing unique conservation patterns .

  2. Functional Redundancy:

    • The NDH complex compensates for lack of ndhE in some mutants, but full activity requires all subunits .

  3. Evolutionary Significance:

    • ndhE’s homology with bacterial enzymes suggests ancestral NDH complex origins in endosymbiotic events .

Critical Data Tables

The recombinant G. hirsutum ndhE is a pivotal tool for studying chloroplast redox biology. Its structural conservation, RNA editing-dependent function, and role in NDH complex activity highlight its importance in photosynthetic adaptation and oxidative stress resilience. Future research should explore its interaction with other subunits and regulatory mechanisms in diverse cotton genotypes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
ndhE
Target Protein Sequence
MMLEHILVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. This process couples the redox reaction to proton translocation, conserving the redox energy in a proton gradient.
Database Links

KEGG: ghi:3989239

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the ndhE gene in the complex allotetraploid genome of Gossypium hirsutum?

The ndhE gene in Gossypium hirsutum exists within the context of a complex allotetraploid genome (2n=52) that arose from the merging of two genomes - the "A" genome (Old World) and the "D" genome (New World). As a chloroplast-encoded gene, ndhE has unique evolutionary patterns distinct from nuclear genes. The cotton genome comprises 26 chromosomes with specific patterns of chromosome-specific recombination that are largely consistent across mapping populations .

When studying ndhE, researchers must consider that:

  • The gene likely appears in both the At and Dt subgenomes with potential homeologous variations

  • High-density genetic linkage maps using SNP markers are essential for correct placement and analysis

  • Comparative analysis between subgenomes may reveal important structural variations or conserved regions in chloroplast genes

Contemporary genetic studies using the CottonSNP63K array have developed high-density genetic linkage maps with 7244 SNP markers spanning 3538 cM, providing a framework for precise genetic studies of specific genes like ndhE .

What approaches are recommended for distinguishing between homeologous copies of ndhE in cotton genomic analyses?

When analyzing ndhE in the upland cotton genome, researchers must employ specialized techniques to differentiate between potential homeologous copies due to cotton's paleopolyploid nature. The following methodological approaches are recommended:

  • Subgenome-specific primer design: Design primers targeting unique flanking sequences specific to each homeolog. This requires:

    • Multiple sequence alignment of potential homeologous regions

    • Identification of subgenome-specific polymorphisms

    • Validation through sequencing of amplification products

  • SNP-based identification: Utilize subgenome-specific SNPs to distinguish between At and Dt homeologs. High-density SNP mapping has revealed that the At and Dt subgenomes contain 1783 and 2041 SNP bins respectively, which can serve as reference points for homeolog identification .

  • RNA-seq analysis with homeolog-specific quantification: When examining expression patterns, implement bioinformatic pipelines specifically designed for polyploid transcriptome analysis.

Table 1: Comparative features of At and Dt subgenomes in Gossypium hirsutum

FeatureAt SubgenomeDt SubgenomeSignificance for ndhE analysis
SNP bin count17832041Higher marker density in Dt subgenome for mapping
Map length (cM)18251713Similar recombination landscapes despite different bin numbers
Evolutionary originOld World (diploid)New World (diploid)Potential functional divergence of homeologs

How does the chloroplastic ndhE gene differ in structure and function from its mitochondrial counterparts?

The chloroplastic ndhE gene encodes a critical subunit of the NAD(P)H dehydrogenase-like (NDH) complex essential for cyclic electron transport around photosystem I. Key structural and functional differences from mitochondrial counterparts include:

  • Genetic origin: The chloroplastic ndhE is encoded by the chloroplast genome, while mitochondrial complex I components are encoded by both nuclear and mitochondrial genomes.

  • Functional role: Chloroplastic ndhE primarily functions in:

    • Cyclic electron flow around photosystem I

    • Chlororespiration

    • Photoprotection under stress conditions

  • Structural differences: The chloroplastic NDH complex has undergone significant evolutionary modifications compared to bacterial and mitochondrial counterparts, with specialized subunits adapted for photosynthetic functions.

When designing experiments targeting ndhE specifically, researchers should use chloroplast isolation protocols that minimize mitochondrial contamination, and employ antibodies or probes with demonstrated specificity for the chloroplastic form.

What genetic mapping approaches are most effective for localizing and characterizing the ndhE gene in Gossypium hirsutum?

For effective genetic mapping of the ndhE gene in Gossypium hirsutum, researchers should implement a multi-faceted approach that accounts for the complex allotetraploid genome structure:

  • High-density SNP mapping: Utilize platforms such as the CottonSNP63K array, which has successfully generated high-density genetic linkage maps spanning the cotton genome. These maps comprise 3824 SNP bins across both the At and Dt subgenomes .

  • Population selection: Choose appropriate mapping populations based on research objectives:

    • F2 populations: Suitable for initial mapping

    • Recombinant inbred lines (RILs): Provide stable, homozygous lines for repeated phenotyping

    • Reciprocal RIL populations: Enable identification of parent-of-origin effects

  • Integration with physical maps: Align genetic mapping data with genomic sequence assemblies to precisely locate the ndhE gene. Previous alignment analyses have successfully integrated SNP sequences with the NBI assembly of Gossypium hirsutum with high congruency .

  • Crossover (CO) analysis: Examine expected recombination frequency on chromosomes to understand genetic linkage patterns, noting that COs appear unaffected by SNP or SNP bin number in different subgenomes .

For chloroplast genes specifically, researchers should note that inheritance patterns will follow maternal inheritance rather than Mendelian segregation, requiring specialized experimental designs.

What experimental protocols are recommended for functional characterization of ndhE mutants in cotton?

When characterizing ndhE mutants in cotton, researchers should implement a comprehensive protocol suite that addresses the unique challenges of working with chloroplastic proteins in a polyploid crop species:

  • Mutant generation approaches:

    • CRISPR-Cas9 genome editing targeting chloroplast transformation

    • RNA interference (RNAi) for knockdown studies

    • Virus-induced gene silencing (VIGS) for transient functional analysis

  • Phenotypic characterization:

    • Photosynthetic efficiency measurements (chlorophyll fluorescence, P700 absorbance)

    • Growth analysis under varying light intensities and abiotic stress conditions

    • Electron transport rate quantification

  • Molecular characterization:

    • Protein complex assembly analysis through BN-PAGE

    • Thylakoid membrane isolation and protein quantification

    • RNA-seq for transcriptional response profiling

For silencing experiments, researchers can adapt methods used for leaf trichome development genes in cotton, where silencing specific genes (e.g., GhHD1) or overexpressing others (e.g., GhGIR1) successfully altered phenotypes . The same silencing constructs and delivery methods can be modified for chloroplast gene studies.

How can genome-wide association studies (GWAS) be leveraged to investigate natural variation in ndhE function across cotton germplasm?

GWAS offers powerful approaches to investigate natural variation in ndhE function across diverse cotton accessions. Based on successful GWAS implementation in cotton research, the following methodology is recommended:

  • Population selection and phenotyping:

    • Assemble a diverse panel (>1000 accessions) similar to the 1037 diverse accessions used in leaf pubescence studies

    • Phenotype for traits potentially influenced by ndhE function, including:

      • Photosynthetic efficiency under various light conditions

      • Stress tolerance parameters

      • Chlorophyll fluorescence measurements

  • Genotyping approaches:

    • Whole-genome resequencing for comprehensive variant discovery

    • SNP array genotyping using platforms like CottonSNP63K

    • Targeted sequencing of chloroplast genome regions

  • Statistical analysis:

    • Implement mixed linear models accounting for population structure

    • Calculate linkage disequilibrium patterns in chloroplast genome regions

    • Identify significant associations between genetic variants and phenotypic traits

  • Validation experiments:

    • Functional validation through gene silencing or overexpression

    • Protein interaction studies to confirm molecular mechanisms

    • Cross-validation in independent germplasm collections

Previous GWAS studies in cotton have successfully identified key loci associated with important traits, such as the three loci (LPA1, LPA2, LPA3) associated with leaf pubescence amount located on chromosomes A06, A08, and A11 respectively . Similar approaches can be adapted for investigating ndhE variation.

How does temperature stress affect ndhE expression and NDH complex function in cotton?

Temperature stress significantly impacts chloroplast gene expression and function in cotton, with potential implications for ndhE expression and NDH complex activity. A comprehensive research approach to this question should include:

  • Expression analysis under temperature stress conditions:

    • qRT-PCR quantification of ndhE transcript levels under normal vs. high temperature conditions

    • RNA-seq for global transcriptional responses of chloroplast genes

    • Protein quantification via western blot analysis

  • NDH complex activity measurements:

    • Chlorophyll fluorescence analysis focusing on post-illumination fluorescence rise

    • P700 reduction kinetics under various temperature regimes

    • Electron transport rates through alternative pathways

  • Integration with physiological responses:

    • Connect molecular data with whole-plant responses to temperature stress

    • Examine correlations between NDH activity and reproductive success under stress

High temperature (HT) conditions have been shown to significantly reduce anther dehiscence rates in cotton , indicating substantial effects on reproductive development. Similar temperature effects likely impact chloroplast function and gene expression. When designing experiments, researchers should:

  • Establish precise temperature control conditions similar to those used in anther dehiscence studies

  • Monitor both acute and chronic temperature stress responses

  • Compare responses across diverse cotton germplasm to identify variation in temperature adaptation mechanisms

What protein-protein interactions are critical for ndhE integration into functional NDH complexes?

Understanding protein-protein interactions involving ndhE is crucial for elucidating NDH complex assembly and function in cotton chloroplasts. Based on protein interaction analysis methods utilized in cotton research, the following experimental approach is recommended:

  • Yeast two-hybrid screening:

    • Use ndhE as bait to identify interacting partners

    • Confirm interactions through reciprocal experiments

    • Quantify interaction strength under varying conditions

  • Co-immunoprecipitation (Co-IP) validation:

    • Generate specific antibodies against ndhE protein

    • Perform Co-IP followed by mass spectrometry to identify interacting proteins

    • Validate key interactions through reciprocal Co-IP

  • Bimolecular Fluorescence Complementation (BiFC):

    • Visualize interactions in planta

    • Map interaction domains through deletion constructs

    • Assess subcellular localization of interaction complexes

Protein interaction studies in cotton have successfully demonstrated that transcription factors like GhHD1 can interact with regulatory proteins such as GhGIR1 and GhGIR2, creating regulatory networks that control trait expression . Similar approaches can reveal how ndhE interacts with other subunits and assembly factors in the chloroplast.

Table 2: Recommended protein interaction validation methods for ndhE studies

MethodAdvantagesLimitationsExpected outcomes
Yeast two-hybridHigh-throughput, quantifiablePotential false positivesInitial interaction map
Co-IP/MSIdentifies native complexesRequires specific antibodiesComprehensive interaction network
BiFCVisualizes interactions in plantaLower throughputSubcellular localization confirmation
Pull-down assaysConfirms direct interactionsRequires purified proteinsBinding affinity data

How can environmental adaptation of cotton be improved through targeted engineering of the ndhE gene?

Targeted engineering of the ndhE gene presents opportunities for enhancing cotton's environmental adaptation, particularly under changing climate conditions. A comprehensive research strategy should include:

  • Functional variation analysis:

    • Screen diverse cotton germplasm for natural ndhE variants

    • Correlate sequence variations with performance under stress conditions

    • Identify promising alleles for targeted engineering

  • Gene editing approaches:

    • Develop chloroplast transformation protocols specific to cotton

    • Design CRISPR-Cas9 constructs targeting specific ndhE modifications

    • Establish efficient regeneration systems for edited plants

  • Phenotypic evaluation framework:

    • Assess photosynthetic efficiency under multiple environmental stresses

    • Examine growth and yield components across diverse environments

    • Evaluate potential ecological impacts through niche modeling approaches

When considering environmental adaptations, researchers should note that cotton already demonstrates significant environmental plasticity, as evidenced by ecological niche modeling of GM cotton with volunteers showing expansion into broader environmental conditions . Targeted engineering of chloroplast genes like ndhE could potentially enhance this adaptive capacity.

For field evaluation, researchers should establish multi-location trials spanning different environmental conditions to thoroughly assess the impact of ndhE modifications on:

This approach aligns with the USDA's Enhanced Cotton for Value-Added Applications research project, which focuses on cotton quality and innovation .

How can high-throughput phenotyping technologies be applied to assess the impact of ndhE variations on cotton performance?

High-throughput phenotyping technologies offer powerful approaches for quantifying subtle phenotypic effects of ndhE variations in cotton. Based on recent advances in cotton phenotyping, researchers should consider:

  • Imaging-based phenotyping platforms:

    • Chlorophyll fluorescence imaging for spatial analysis of photosynthetic efficiency

    • Hyperspectral imaging for biochemical composition assessment

    • Thermal imaging for water stress response evaluation

  • Automated data collection systems:

    • Adapt systems like the cotton florescence detection system based on Faster R-CNN

    • Implement ground mobile systems (e.g., GPhenoVision) for field-based assessments

    • Develop custom algorithms for photosynthesis-specific trait extraction

  • Data integration and analysis:

    • Machine learning approaches for complex trait prediction

    • Multi-trait analysis incorporating physiological and molecular data

    • Temporal analysis of stress responses and recovery patterns

Cotton researchers have successfully implemented deep learning-based systems for phenotyping traits like anther dehiscence using YOLOv5 and Faster R-CNN models . Similar computer vision approaches could be adapted for quantifying subtle phenotypic effects of ndhE variations on photosynthetic efficiency and stress responses.

What are the most effective experimental designs for investigating ndhE gene expression patterns across developmental stages and tissues in cotton?

To comprehensively characterize ndhE expression patterns throughout cotton development, researchers should implement a multi-faceted experimental design:

  • Tissue sampling strategy:

    • Collect tissues from multiple developmental stages (seedling to maturity)

    • Include various tissue types (leaves, stems, reproductive structures)

    • Sample at different times of day to capture diurnal regulation

  • Expression quantification methods:

    • qRT-PCR with chloroplast-specific reference genes

    • RNA-seq with protocols optimized for chloroplast transcripts

    • In situ hybridization for spatial resolution within tissues

  • Data analysis approach:

    • Normalize expression data accounting for chloroplast copy number variations

    • Implement time-series analysis for developmental progression

    • Correlate expression patterns with physiological measurements

  • Validation strategy:

    • Protein quantification using western blots with specific antibodies

    • Reporter gene constructs for visualizing expression patterns

    • Correlation analysis with related chloroplast genes

How does the evolutionary conservation of ndhE across Gossypium species inform functional predictions and engineering strategies?

Comparative evolutionary analysis of ndhE across Gossypium species provides crucial insights for functional predictions and targeted engineering approaches:

  • Phylogenetic analysis framework:

    • Sequence ndhE from multiple Gossypium species and outgroups

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Calculate selection pressures (dN/dS ratios) to identify functional constraints

  • Structure-function correlation:

    • Map conserved residues onto protein structural models

    • Identify species-specific variations in functional domains

    • Predict critical residues for protein-protein interactions

  • Experimental validation approaches:

    • Express variants from different species in model systems

    • Measure functional parameters of different natural variants

    • Test engineered chimeric proteins combining domains from different species

This evolutionary approach builds on the understanding of cotton's complex genomic history, including the historical ancestral At-subgenomic translocations of chromosomes c02 and c03, as well as c04 and c05 identified through comparative alignment analyses . Similar evolutionary analyses of chloroplast genes can reveal important functional constraints and adaptation patterns.

Table 3: Comparative features of ndhE across selected Gossypium species

SpeciesGenome TypeHabitatKey ndhE Sequence FeaturesFunctional Implications
G. hirsutumAllotetraploid (AD)VariousReference sequenceBroad adaptation range
G. barbadenseAllotetraploid (AD)TropicalPotential sequence variationsAdaptation to specific conditions
G. arboreumDiploid (A)Old WorldA-genome ancestral stateHistorical functional state
G. raimondiiDiploid (D)New WorldD-genome ancestral stateHistorical functional state

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.