Recombinant Gossypium hirsutum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Sequence and Evolutionary Conservation

The ndhG gene is highly conserved across plant species. For example:

  • Mesostigma viride ndhG: 189 amino acids with iron-sulfur (Fe-S) binding motifs .

  • Draba nemorosa ndhG: Shares 76% sequence similarity with G. hirsutum homologs .

Notable motifs in ndhG:

  • Transmembrane domains (residues 15–35, 50–70) .

  • Plastoquinone-binding site (residues 120–140) .

Role in Cotton Chloroplasts

In G. hirsutum, ndh subunits are critical for stress adaptation and fiber development:

  • RNA editing: Post-transcriptional modifications in ndh genes (e.g., ndhA, ndhB) alter protein structures, enhancing photosynthetic efficiency under stress .

  • Fiber quality: Mutations in NDH-related genes (e.g., GhCesA4) correlate with cellulose synthesis and fiber strength .

Research Gaps and Future Directions

  • Functional studies: No direct kinetic or structural data exists for recombinant G. hirsutum ndhG.

  • Applications: Potential utility in improving crop stress tolerance via chloroplast engineering .

References (Integrated Citations)

  1. Recombinant ndhG production in E. coli .

  2. RNA editing in G. hirsutum chloroplasts .

  3. NDH complex functionality in photosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery estimates.
Note: All protein shipments are standardly equipped with blue ice packs. Should you require dry ice for shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAA AQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTIGNGLTSLVCTSILVSLITTILDTSW YGIIWTTRSNQIIEQDLISNSQQIGIHLATDFFLPFEFISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH facilitates the transfer of electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. This process couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: ghi:3989238

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of ndhG in Gossypium hirsutum chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is an essential component of the chloroplast NAD(P)H dehydrogenase (NDH) complex in cotton (Gossypium hirsutum). This protein is encoded by the chloroplast genome and functions as part of the electron transport chain, facilitating cyclic electron flow around photosystem I. The ndhG gene belongs to the larger ndh gene family that collectively encodes various subunits of the NDH complex. In cotton, this complex plays crucial roles in photoprotection, particularly under stress conditions such as high light intensity or drought.

Structurally, the ndhG gene in G. hirsutum follows the conserved pattern observed in other plant species, though with cotton-specific features related to its allotetraploid (AtDt) genome organization. The gene is located in the chloroplast genome, which in cotton consists of 131 genes, including 78 protein-coding genes . The chloroplast genome of cotton has been fully sequenced, revealing important structural features that influence the expression and function of genes like ndhG .

How does RNA editing affect ndhG transcript processing in Gossypium hirsutum?

RNA editing is a critical post-transcriptional modification process in plant chloroplasts that changes specific cytidine (C) residues to uridine (U) in mRNA transcripts. In cotton chloroplasts, RNA editing plays a significant role in the proper expression of many genes, including those in the ndh family. Research has identified a total of 54 editing sites in 27 transcripts within cotton chloroplasts .

While specific data for ndhG is not directly mentioned in the available literature, the pattern observed in related ndh genes provides important insights. For instance, the ndhD transcript in cotton has 11 editing sites that are fully edited, including a site that creates a new start codon . Similarly, other ndh family genes show characteristic editing patterns that are essential for proper protein function.

The distribution of RNA editing in cotton chloroplast genes is not random, with 87.0% of identified editing sites occurring in the second position of the codon, 11.1% in the first position, and only 1.9% in the third position . This codon position bias is significant because editing in the second position typically results in more dramatic amino acid changes that can fundamentally alter protein structure and function.

What are the appropriate experimental controls when studying recombinant ndhG expression?

When studying recombinant ndhG expression in G. hirsutum, several experimental controls are essential to ensure the validity and reliability of results:

  • Negative Controls:

    • Untransformed plant tissues or cells

    • Expression vectors without the ndhG insert

    • Reactions without the reverse transcriptase enzyme for RNA analysis

  • Positive Controls:

    • Known-expression chloroplast genes (such as rbcL)

    • Previously validated recombinant constructs

    • Synthetic ndhG transcript or protein standards

  • Internal Controls:

    • Housekeeping genes for normalization (e.g., 18S rRNA, actin)

    • Spiked-in RNA/DNA standards for quantification

    • Tissue-specific markers to confirm chloroplast isolation purity

The experimental design should also account for the specialized growth conditions of cotton. Plants should be grown under controlled conditions (16-hour light/8-hour dark cycle at 28°C) to ensure consistency, as described in protocols for similar chloroplast gene studies . Additionally, DNA isolation should follow validated methods such as the modified SDS-CTAB method used in chloroplast genome research .

What methodologies are most effective for identifying RNA editing sites in the ndhG transcript?

Identifying RNA editing sites in ndhG transcripts requires a systematic approach combining multiple molecular techniques:

  • RT-PCR and Sequencing Approach:

    • Design primers specific to the ndhG coding region based on the chloroplast genome sequence of cotton (reference: DQ345959)

    • Perform parallel amplification of genomic DNA (gDNA) and complementary DNA (cDNA)

    • Sequence both products and align them to identify C-to-U changes

    • Validate editing sites through multiple independent clones and bidirectional sequencing

  • High-throughput RNA-Seq Approach:

    • Perform strand-specific RNA sequencing of chloroplast transcripts

    • Map reads to the reference chloroplast genome

    • Identify variations between RNA reads and the reference genome

    • Apply computational filters to distinguish RNA editing events from sequencing errors or SNPs

  • Site-specific Analysis:

    • Target predicted editing sites based on consensus sequences (typically with U_A context bias observed in cotton chloroplast editing)

    • Use poisoned primer extension or mismatch-specific endonucleases to verify specific editing events

    • Quantify editing efficiency at each site using methods such as High Resolution Melting analysis

The effectiveness of these methods can be enhanced by focusing on the codon context, as 87.0% of cotton chloroplast RNA editing events occur in the second position of codons . Also, comparative analysis with other ndh genes can guide the search, as editing patterns are often conserved within gene families.

How can researchers accurately characterize the protein structure changes resulting from RNA editing in ndhG?

Characterizing protein structure changes resulting from RNA editing requires a comprehensive approach that integrates computational prediction with experimental validation:

Table 1: Methodological Approach to Characterizing ndhG Protein Structure Changes

ApproachMethodsKey ApplicationsAdvantages
Computational PredictionSecondary structure prediction (e.g., PSIPRED)Predict α-helices, β-sheetsRapid, initial assessment
Tertiary structure homology modelingModel full protein structureProvides visual representation
Molecular dynamics simulationsAssess structural stabilityEvaluates dynamic properties
Experimental ValidationCircular dichroism spectroscopyVerify secondary structure elementsDirect measurement of structure
X-ray crystallographyDetermine high-resolution structureGold standard for structure
Nuclear magnetic resonance (NMR)Analyze structure in solutionGood for dynamic regions
Functional AssessmentSite-directed mutagenesisTest specific edited residuesConfirms functional importance
Protein-protein interaction assaysEvaluate assembly into NDH complexAssesses biological relevance

Research on other chloroplast transcripts has shown that RNA editing can significantly impact protein folding and function. Of the 54 editing sites identified in cotton chloroplast transcripts, 24 were found to affect protein secondary structures and/or 3D structures . These editing events typically restore evolutionarily conserved amino acids, suggesting their importance for proper protein function.

For ndhG specifically, researchers should:

  • Compare edited and unedited protein sequences

  • Predict structural changes using bioinformatics tools

  • Focus on evolutionarily conserved sites

  • Validate predictions through experimental approaches

What approaches can be used to analyze contradictions in experimental data when studying ndhG?

When analyzing contradictions in ndhG experimental data, researchers can employ a structured approach based on contradiction pattern notation and resolution strategies:

  • Structured Notation of Contradictions:

    • Implement the (α, β, θ) notation system, where α represents the number of interdependent data items, β represents the number of contradictory dependencies, and θ represents the minimal number of required Boolean rules to assess these contradictions

    • For example, a contradiction between expression level and protein accumulation would be classified as a (2,1,1) pattern

    • More complex contradictions involving multiple factors would require higher-order patterns

  • Data Quality Assessment:

    • Apply specialized data quality frameworks to identify impossible combinations of values in interdependent data items

    • Implement specific Boolean rules to test for data consistency

    • Compare results across biological replicates to distinguish true biological variation from technical artifacts

  • Resolution Strategies:

    • Metadata analysis: Examine experimental conditions that might explain discrepancies

    • Technical validation: Repeat key experiments using alternative methods

    • Domain knowledge integration: Apply chloroplast biology principles to interpret seemingly contradictory results

    • Statistical approaches: Use appropriate statistical tests to determine if contradictions exceed expected variance

For complex contradictions in ndhG research, the minimum number of Boolean rules required might be significantly lower than the number of described contradictions , allowing for efficient troubleshooting of experimental inconsistencies.

How does the allotetraploid genome structure of Gossypium hirsutum influence ndhG expression and function?

The allotetraploid (AtDt) genome structure of Gossypium hirsutum significantly influences the expression and function of chloroplast genes, including ndhG, through complex genomic and evolutionary mechanisms:

Gossypium hirsutum possesses an allotetraploid genome resulting from the hybridization of A and D genome species, creating a complex genetic background with 26 chromosomes . This genome structure presents unique challenges and characteristics for chloroplast gene expression:

  • Genome-Plastome Interactions:

    • The nuclear genome (both At and Dt subgenomes) encodes regulatory factors that influence chloroplast gene expression

    • Differential regulation from the two subgenomes may create unique expression patterns for chloroplast genes like ndhG

    • The interaction between subgenome-specific nuclear factors and the conserved chloroplast genome creates cotton-specific regulatory networks

  • Evolutionary Implications:

    • Analysis of the G. hirsutum genome reveals that transposable elements originating from the Dt subgenome appear more active than those from the At subgenome

    • The A or At genome may have undergone positive selection for fiber traits , potentially affecting chloroplast function in fiber cells

    • Genome size reduction occurred after allopolyploidization , which may have streamlined regulatory networks

  • Concerted Evolution:

    • Concerted evolution of different regulatory mechanisms has been observed for key genes in cotton

    • Similar mechanisms may apply to the regulation of ndh genes, including ndhG

    • These regulatory adaptations may enhance chloroplast function in fiber development and stress response

Research approaches should account for these genome complexities by:

  • Comparing ndhG expression in allotetraploid G. hirsutum with its diploid progenitors

  • Analyzing subgenome-specific regulatory elements affecting chloroplast gene expression

  • Investigating fiber-specific expression patterns of chloroplast genes

What are the most effective experimental designs for functional characterization of RNA-edited ndhG in vivo?

Functional characterization of RNA-edited ndhG in vivo requires sophisticated experimental designs that can disentangle complex biological processes:

Table 2: Advanced Experimental Designs for ndhG Functional Characterization

Experimental ApproachKey MethodologyMeasured ParametersResearch Applications
Chloroplast TransformationBiolistic transformation with editing site mutationsPhotosynthetic efficiency, NDH activityDirect assessment of editing site importance
CRISPR-Cas9 Editing of PPR ProteinsTargeted editing of nuclear-encoded editing factorsEditing efficiency, physiological effectsIndirect manipulation of editing machinery
Inducible RNA InterferenceTemporally controlled knockdown of ndhG transcriptsTime-course of phenotypic effectsDevelopmental stage-specific analysis
Synthetic Biology ApproachIntroduction of pre-edited versus genomic ndhGComplementation efficiency in mutantsDirect comparison of edited vs. unedited forms
Environmental Stress TestingExposure to high light, drought, temperature extremesStress tolerance, ROS productionFunctional relevance under stress conditions

When designing these experiments, researchers should:

  • Control for Tissue-Specific Effects:

    • Isolate chloroplasts from different cotton tissues, as RNA editing may vary by tissue type

    • Compare results between photosynthetic and non-photosynthetic tissues

  • Implement Proper Controls:

    • Include wild-type controls and plants with mutations in other ndh genes

    • Use appropriate nuclear genome backgrounds to control for subgenome-specific effects in the allotetraploid cotton

  • Quantitative Analysis:

    • Measure editing efficiency using high-resolution techniques

    • Correlate editing levels with functional parameters

    • Apply statistical models appropriate for the complex datasets generated

This multilayered approach enables comprehensive characterization of how RNA editing of ndhG contributes to chloroplast function in cotton.

What methodological approaches are recommended for integrating ndhG research with whole-genome studies in Gossypium hirsutum?

Integrating chloroplast ndhG research with whole-genome studies in Gossypium hirsutum requires sophisticated methodological approaches that bridge organellar and nuclear genomics:

  • Multi-omics Integration Framework:

    • Combine chloroplast transcriptomics with nuclear genome expression data

    • Correlate ndhG editing patterns with expression of nuclear-encoded editing factors

    • Integrate proteomics to verify translation of edited transcripts

    • Apply metabolomics to link ndhG function to metabolic pathways

  • Advanced Sequencing Strategies:

    • Implement long-read sequencing technologies (PacBio, Nanopore) to capture full-length transcripts including editing sites

    • Apply BAC-to-BAC sequencing approaches similar to those used in cotton genome sequencing

    • Develop targeted sequencing panels that capture both chloroplast genes and nuclear genes involved in chloroplast function

  • Bioinformatic Pipelines:

    • Develop specialized algorithms to detect editing events in high-throughput data

    • Implement tools that can handle the complexity of allotetraploid genome data

    • Create visualization methods to represent the interplay between organellar and nuclear genomes

  • Experimental Design Considerations:

    • Account for tissue-specific and developmental variation in both chloroplast and nuclear gene expression

    • Design experiments that capture environmental responses across both genomic compartments

    • Implement carefully controlled growth conditions (16-hour light/8-hour dark cycle at 28°C) to ensure reproducibility

Integration of ndhG research with whole-genome studies must account for the fact that while only 88.5% of the 2,173-Mb nuclear genome scaffolds have been anchored to pseudochromosomes , the chloroplast genome is completely sequenced and well-characterized. This difference in genomic resolution must be considered when interpreting integrated datasets.

How can contradictions in ndhG functional data be systematically analyzed and resolved?

Contradictions in ndhG functional data can be systematically analyzed and resolved through a structured approach that combines domain knowledge with data quality assessment frameworks:

  • Contradiction Pattern Classification:

    • Apply the (α, β, θ) notation to classify contradiction types in ndhG research

    • Identify the minimum number of Boolean rules needed to detect each contradiction class

    • Develop cotton-specific contradiction patterns based on chloroplast biology principles

  • Multidimensional Analysis Framework:

    • Implement structured evaluation methods for complex interdependencies in functional data

    • Distinguish between contradictions arising from biological variation versus methodological inconsistencies

    • Apply domain-specific knowledge about chloroplast gene function to interpret conflicting results

  • Data Quality Assessment Pipeline:

    • Develop specialized tools for detecting contradictions in chloroplast gene functional data

    • Implement both automated and expert-guided contradiction resolution pathways

    • Create standardized protocols for reporting potential contradictions and their resolution

When analyzing contradictions, researchers should consider that while there might be a different number of contradictions formulated by domain experts, structured analysis helps handle the complexity of multidimensional interdependencies within biological datasets . This approach is particularly valuable for ndhG research, where data may come from diverse experimental platforms and biological contexts.

What innovations in research design would advance our understanding of recombinant ndhG function?

Several innovative research designs could significantly advance our understanding of recombinant ndhG function in cotton:

  • Single-Molecule Approaches:

    • Apply single-molecule real-time sequencing to detect RNA editing events with unprecedented precision

    • Develop single-chloroplast isolation and analysis techniques to examine organelle-level variation

    • Implement super-resolution microscopy to visualize NDH complex assembly with edited ndhG

  • Synthetic Biology Innovations:

    • Design synthetic chloroplast genomes with modified ndhG editing sites

    • Create chimeric ndhG variants to map functional domains

    • Develop optogenetic control systems for ndhG expression

  • Environmental Response Platforms:

    • Build high-throughput phenotyping systems to assess ndhG function under diverse stresses

    • Develop field-deployable sensors to monitor chloroplast function in real-time

    • Create controlled environment systems that can simulate complex climate scenarios

  • Integrative Data Analysis Frameworks:

    • Implement machine learning approaches to predict editing patterns and functional outcomes

    • Develop network analysis tools to place ndhG in the broader context of chloroplast function

    • Create visualization tools that can represent multilevel data from genome to phenome

These innovations would help overcome current limitations in understanding how RNA editing of ndhG contributes to cotton adaptation to environmental stresses, potentially leading to applications in crop improvement.

How can researchers effectively compare ndhG RNA editing patterns across Gossypium species for evolutionary insights?

Effective comparison of ndhG RNA editing patterns across Gossypium species requires a systematic approach combining phylogenetic analysis with functional evaluation:

Table 3: Comparative Framework for ndhG RNA Editing Analysis

Analytical DimensionMethodological ApproachEvolutionary InsightsTechnical Considerations
Sequence ConservationMultiple sequence alignment of ndhG across speciesIdentification of conserved editing sitesAccount for genome differences between diploid and tetraploid species
Editing EfficiencyQuantitative analysis of editing extent at each siteDetection of species-specific editing patternsStandardize RNA extraction and analysis protocols
Codon Context AnalysisExamination of nucleotide context around editing sitesRecognition of species-specific editing mechanismsConsider U_A context bias observed in cotton editing
Functional ConservationComparison of edited protein structuresIdentification of functionally critical editing eventsIntegrate with protein modeling approaches
Phylogenetic MappingMapping of editing events on Gossypium phylogenyReconstruction of editing evolution in the genusAccount for allopolyploidization events

When implementing this comparative framework, researchers should:

  • Include both diploid progenitor species (G. arboreum and G. raimondii) and the allotetraploid G. hirsutum in analyses

  • Consider that 18 RNA editing sites have been identified as unique to cotton when compared to other species

  • Focus analysis on sites that restore evolutionarily conserved amino acids

  • Examine whether RNA editing compensates for genomic mutations that occurred during Gossypium evolution

This comparative approach can reveal whether RNA editing evolved as a compensatory mechanism following genomic changes during cotton speciation and polyploidization, providing insights into both molecular evolution and functional adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.