Recombinant Gossypium hirsutum Oleosin 16.4 kDa (MATP7)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MATP7; Oleosin 16.4 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-154
Protein Length
Full Length of Mature Protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
MATP7
Target Protein Sequence
ADRDRSYRTFDQVVRGDRTNYQSGPSTTQVLTVLTLLPIGGTLLALAGLTLTGTVIGLCM
ATPLFVIFSPVLVPAAIAVFMAVAGFLSSGAFGLTGLSSLSYVFNRFRQATGTEQLDADR
AKRGMQDMVGYVGQKTKETGQTIENKAHEGGRT
Uniprot No.
Target Background
Function
Oleosin plays a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Database Links
KEGG: ghi:107888658
UniGene: Ghi.8035
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
