Recombinant Gossypium hirsutum Oleosin 18.2 kDa (MATP6-A)

What is the molecular structure of Gossypium hirsutum Oleosin 18.2 kDa (MATP6-A)?

Gossypium hirsutum Oleosin 18.2 kDa (MATP6-A) is a structural protein found in oil bodies of cotton seeds. According to structural analyses, the protein exhibits the following characteristics:

• Amino Acid Sequence: AEVRDRNLPHQVQVHPQYRLDNTTGGGYGAKNYHSGPSTSQVLAVLTLLPIGGTLLALAGLTLAGTVIGLLLATPLFIIFSPVLVPAAIAIAMAAVTGFLSSGAFGLTGLSSLSYVLNRLRYATGTEQLDLDHAKRRVQDMTEYVGQKTKEVGQKIENKAHEGQVGRT

• Secondary Structure: Dominated by α-helices (>60%), as predicted through AlphaFold 2 modeling

• Structural Domains: Contains a central hydrophobic domain flanked by amphipathic regions that interact with the phospholipid monolayer of oil bodies

• Expression Region: 2-168 amino acids

• UniProt Accession: P29527

The protein's characteristic tripartite structure (N-terminal amphipathic domain, central hydrophobic domain, and C-terminal amphipathic domain) allows it to effectively stabilize oil bodies in the seed.

How do oleosins differ between cotton species, and what is unique about G. hirsutum Oleosin 18.2 kDa?

Comparative genomic analyses have revealed significant differences in the oleosin gene family across cotton species:

• G. hirsutum: Contains 25 OLEO genes

• G. barbadense: Contains 24 OLEO genes

• G. arboreum: Contains 12 OLEO genes

• G. raimondii: Contains 13 OLEO genes

G. hirsutum Oleosin 18.2 kDa (MATP6-A) belongs to the seed-specific lineage of oleosins and shows particularly high expression in developing cotton ovules at 10-20 days post-anthesis (dpa) . This temporal expression pattern coincides with the period of active oil accumulation in cotton seeds, suggesting its important role in oil body formation and stabilization.

The 74 OLEO genes identified across these four cotton species cluster into three distinct lineages based on phylogenetic analysis, with MATP6-A belonging to the seed-specific lineage that is evolutionarily conserved .

What are the most effective methods for extracting and purifying recombinant G. hirsutum Oleosin 18.2 kDa for research purposes?

For optimal extraction and purification of Gossypium hirsutum Oleosin 18.2 kDa, researchers should consider the following protocol, which has demonstrated high purity yields:

• Initial Preparation:

  • Isolate oil bodies (OBs) from cotton seeds through differential centrifugation

  • Wash isolated OBs twice with urea solution to remove weakly associated proteins

• Defatting and Solubilization:

  • Treat with Folch solution (chloroform-methanol mixture)

  • Follow with cold acetone wash

  • Final extraction with petroleum ether

• Optimization Parameters:

  • Chloroform-methanol ratio significantly impacts extraction efficiency

  • A ratio of 11:7 (chloroform:methanol) has shown extraction purity of up to 78.7%

  • Sequential extraction with methanol, hexane, and ethanol has demonstrated recovery rates of 94±1.4% with purity of 87.1±1.9%

• Verification:

  • Confirm purity using SDS-PAGE, FTIR, and SEM-EDS techniques

  • Verify protein content using elemental analysis (multiply N element content by 6.25)

This methodology exploits the hydrophobic nature of oleosins, which is the main driving force behind their assembly and interaction with oil bodies.

How can researchers distinguish between oleosin-H and oleosin-L subtypes during purification procedures?

Effective differentiation between oleosin subtypes requires understanding their distinct physicochemical properties:

Distinguishing Characteristics:

• Oleosin-H (16-17 kDa): Exhibits limited water solubility

• Oleosin-L (13-14 kDa): Constitutes the non-soluble fraction

Separation Protocol:

• After initial extraction of total oleosins, perform differential solubility testing

• Use sequential solvent extraction with increasing polarity

• Apply SDS-PAGE to differentiate the subtypes based on molecular weight

• Confirm identity through mass spectrometry or western blotting with subtype-specific antibodies

Performance Metrics:
The following table summarizes the effectiveness of different solvent systems for oleosin subtype separation:

Note: These values are approximate ranges based on published data . Optimization may be required for specific research applications.

What expression systems are most suitable for recombinant production of G. hirsutum Oleosin 18.2 kDa, and what challenges might researchers encounter?

Optimal Expression Systems:

• E. coli-based Systems:

  • BL21(DE3) strain with pET vector systems offers high yield

  • Codon optimization is essential due to differences between plant and bacterial codon usage

  • Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8 typically provides optimal expression

  • Challenge: Tendency to form inclusion bodies due to the highly hydrophobic central domain

• Yeast Expression Systems:

  • Pichia pastoris shows better folding capability for oleosin proteins

  • Can be directed to intracellular oil bodies when co-expressed with diacylglycerol acyltransferase

  • Challenge: Glycosylation patterns differ from native plant systems

• Plant-based Expression:

  • Arabidopsis thaliana or Nicotiana benthamiana transient expression systems

  • More natural post-translational modifications

  • Challenge: Lower yield compared to microbial systems

Common Challenges and Solutions:

When working with recombinant G. hirsutum Oleosin 18.2 kDa, researchers should carefully consider these system-specific factors to optimize yield and functionality.

What methods can researchers use to analyze the oil body binding capabilities of recombinant G. hirsutum Oleosin 18.2 kDa?

Experimental Approaches for Oil Body Binding Analysis:

• Artificial Oil Body (AOB) Reconstitution Assay:

  • Create artificial oil bodies using triacylglycerol, phospholipids, and purified recombinant oleosin

  • Analyze size distribution using dynamic light scattering

  • Assess stability through temperature and pH challenge tests

  • Measure zeta potential to evaluate surface charge characteristics

• Fluorescence Labeling and Microscopy:

  • Tag recombinant oleosin with fluorescent markers (GFP, mCherry)

  • Observe localization to oil bodies in vivo or in reconstituted systems

  • Use FRAP (Fluorescence Recovery After Photobleaching) to measure mobility within the oil body monolayer

• Binding Kinetics Analysis:

  • Surface plasmon resonance with immobilized phospholipid monolayers

  • Isothermal titration calorimetry to determine thermodynamic parameters

  • Binding competition assays with native oleosins

Data Interpretation Guidelines:

• Strong binding is typically characterized by Kd values in the nanomolar range

• Effective stabilization correlates with smaller and more uniform oil body size distribution

• Native-like function should show similar subcellular localization to endogenous oleosins

How can transgenic expression of G. hirsutum Oleosin 18.2 kDa be used to study seed oil content and germination?

Transgenic expression studies have revealed significant insights into the functional roles of oleosins:

Experimental Design for Transgenic Studies:

• Overexpression in Model Systems:

  • Transform Arabidopsis thaliana with G. hirsutum Oleosin 18.2 kDa under control of a seed-specific promoter

  • Select homozygous transgenic lines with varying expression levels

  • Compare with wild-type and knockout lines

• Phenotypic Analysis:

  • Seed oil content measurement using gas chromatography

  • Germination rate assessment under normal, salt stress, and chilling conditions

  • Microscopic analysis of oil body size and distribution

Research Findings:
Transgenic Arabidopsis overexpressing cotton oleosins has demonstrated:

• Increased seed oil content compared to wild-type plants

• Decreased seed germination rates, particularly under stress conditions

• Altered oil body morphology with reduced average diameter

These findings suggest that G. hirsutum Oleosin 18.2 kDa plays dual roles in:

• Enhancing oil accumulation during seed development

• Regulating the mobilization of stored lipids during germination

What transmembrane models exist for Oleosin 18.2 kDa, and how do they influence experimental design?

Research into oleosin transmembrane structure has identified three distinct models:

Transmembrane Models:

• Classic "Hairpin" Model:

  • Central hydrophobic domain forms a hairpin structure that penetrates the phospholipid monolayer

  • N and C-terminal hydrophilic domains remain on the oil body surface

  • This model explains the stability of oil bodies through steric hindrance

• "Extended Central" Model:

  • The central hydrophobic domain forms multiple transmembrane segments

  • Creates a more complex anchoring system within the oil body

  • Recently proposed based on computational predictions

• "Partial Penetration" Model:

  • Only portions of the central domain penetrate the phospholipid monolayer

  • Other regions interact with adjacent oleosins, forming a protein network

  • Also recently proposed based on new structural analyses

Implications for Experimental Design:

Understanding the correct transmembrane model is crucial for designing targeted modifications that can enhance or alter oleosin functionality in biotechnological applications.

How do post-translational modifications affect the function of G. hirsutum Oleosin 18.2 kDa in oil body dynamics?

Post-translational modifications (PTMs) significantly impact oleosin function throughout the seed lifecycle:

Key Post-translational Modifications:

• Phosphorylation:

  • Occurs primarily on serine and threonine residues

  • Regulates association/dissociation with oil bodies during germination

  • Can be analyzed using phospho-specific antibodies or mass spectrometry

• Ubiquitination:

  • Targets oleosins for degradation during germination

  • Enables access of lipases to the oil body surface

  • K48-linked polyubiquitin chains signal for proteasomal degradation

• Proteolytic Processing:

  • Specific proteases target oleosins during seed germination

  • Results in fragmentation that destabilizes oil bodies

  • Can be monitored using protease inhibitor studies

Research Techniques for PTM Analysis:

• Phosphorylation mapping using LC-MS/MS

• In vitro ubiquitination assays with seed extracts

• Pulse-chase experiments to monitor protein turnover

• Site-directed mutagenesis of putative modification sites

Understanding these modifications provides insight into how the plant regulates oil mobilization during germination, which has implications for both basic science and biotechnological applications aimed at modifying seed oil content.

What does synteny analysis reveal about the evolution of the MATP6-A gene in Gossypium species?

Synteny analysis of oleosin genes across cotton species has provided valuable insights into their evolutionary history:

Key Findings from Evolutionary Studies:

• Gene Duplication Mechanisms:

  • Whole Genome Duplication (WGD) and segmental duplications are the primary drivers of oleosin gene family expansion in cotton

  • The MATP6-A gene shows conservation across multiple Gossypium species, indicating functional importance

• Syntenic Relationships:

  • Most oleosin genes (including MATP6-A) are highly conserved in their chromosomal positions

  • Paralogous genes show similar expression patterns, suggesting functional conservation after duplication

• Selection Pressure:

  • Ka/Ks ratio analysis indicates that most oleosin genes are under purifying selection

  • The central hydrophobic domain shows particularly strong sequence conservation across species

Evolutionary Model:
The current evidence suggests that the ancestral oleosin gene underwent duplication and diversification before the divergence of diploid cotton species. The tetraploidization event that led to G. hirsutum and G. barbadense then doubled the gene complement, with subsequent minor gene losses or gains.

This evolutionary history explains why G. hirsutum possesses approximately twice as many OLEO genes (25) as its diploid progenitors G. arboreum (12) and G. raimondii (13) .

How does the regulation of G. hirsutum Oleosin 18.2 kDa compare with oleosins in other oil-producing crops?

Comparative analysis reveals both conserved and divergent regulatory mechanisms across plant species:

Regulatory Comparison:

• Transcriptional Regulation:

  • Cotton oleosins show peak expression at 10-20 days post-anthesis (dpa)

  • This timing differs from Arabidopsis (mid-maturation) and soybean (later maturation)

  • Conserved cis-regulatory elements include ABA-responsive elements and seed-specific motifs

• miRNA Regulation:

  • 24 candidate miRNAs targeting G. hirsutum OLEOs have been identified

  • miRNA-OLEO regulatory networks differ between monocots and dicots

  • Some regulatory miRNAs are conserved across multiple species, while others are lineage-specific

• Expression Pattern Comparison:

DAF = Days After Flowering

These comparative analyses highlight both the conserved functions of oleosins across plants and their species-specific adaptations, providing insights for targeted genetic engineering of oil-producing crops.

How can researchers use recombinant G. hirsutum Oleosin 18.2 kDa to modulate seed oil content in crops?

Biotechnological Strategies:

• Overexpression Approaches:

  • Transgenic expression of G. hirsutum Oleosin 18.2 kDa under seed-specific promoters

  • Demonstrated increases in seed oil content in model plants like Arabidopsis

  • The mechanism likely involves formation of smaller, more stable oil bodies with higher surface-to-volume ratio

• Gene Editing Considerations:

  • CRISPR/Cas9 modification of endogenous oleosin genes to match beneficial G. hirsutum variants

  • Target promoter regions to alter expression patterns rather than protein sequence

  • Edit specific amino acids in the central hydrophobic domain to modify oil body stability

• Co-expression Strategies:

  • Combine oleosin modifications with enhanced expression of fatty acid biosynthesis genes

  • Balance oleosin isoform ratios (H vs. L types) to optimize oil body size and stability

  • Express cotton oleosins in other crop species with suboptimal oil body formation

Performance Data:
Transgenic Arabidopsis plants overexpressing cotton oleosins have shown:

• 15-20% increase in total seed oil content

• Altered fatty acid profiles with increased unsaturated fatty acids

• Delayed germination, particularly under stress conditions

These findings suggest significant potential for oleosin engineering in crop improvement programs focused on oilseed enhancement.

What are the methodological challenges in studying the interactions between G. hirsutum Oleosin 18.2 kDa and lipid metabolism enzymes?

Research Challenges and Solutions:

• Protein-Protein Interaction Detection:

  • Challenge: Membrane-associated nature of oleosins complicates traditional interaction assays

  • Solution: Bimolecular Fluorescence Complementation (BiFC) in planta; Split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

• Temporal Dynamics Analysis:

  • Challenge: Interactions may be transient or occur only during specific developmental stages

  • Solution: Inducible expression systems; in vivo imaging with temporally controlled expression

• Oil Body Isolation Without Disrupting Interactions:

  • Challenge: Conventional isolation methods may disrupt weak or transient interactions

  • Solution: Chemical cross-linking prior to isolation; proximity labeling approaches (BioID, APEX)

• Functional Validation of Interactions:

  • Challenge: Determining whether observed interactions are physiologically relevant

  • Solution: Combine interaction studies with metabolic flux analysis; conduct parallel enzyme activity assays

Experimental Design Framework:

These methodological considerations will help researchers design robust experiments to elucidate the functional relationships between oleosins and lipid metabolism enzymes.

What are common technical issues when working with recombinant G. hirsutum Oleosin 18.2 kDa, and how can researchers address them?

Common Technical Challenges and Solutions:

• Protein Aggregation During Purification:

  • Problem: The highly hydrophobic central domain tends to drive aggregation

  • Solution: Add 0.5-1% mild detergents (Triton X-100, CHAPS); maintain low temperature throughout purification; use denaturing conditions followed by careful refolding

• Inconsistent Reconstitution into Artificial Oil Bodies:

  • Problem: Variable size and stability of reconstituted oil bodies

  • Solution: Standardize phospholipid:TAG:oleosin ratios; use controlled sonication or microfluidic homogenization; verify protein orientation using protease protection assays

• Difficult Antibody Generation:

  • Problem: The conserved nature of oleosins makes specific antibody production challenging

  • Solution: Target unique epitopes in N- or C-terminal domains; use synthetic peptides for immunization; validate specificity against multiple oleosin isoforms

• Variable Expression in Heterologous Systems:

  • Problem: Inconsistent yields across expression batches

  • Solution: Optimize codon usage; use controlled induction protocols; standardize growth conditions; consider co-expression of chaperones

Troubleshooting Decision Tree:

For protein solubility issues:

• Is aggregation occurring during expression?

  • If yes: Lower induction temperature to 16-20°C

  • If no: Proceed to next step

• Is aggregation occurring during purification?

  • If yes: Add appropriate detergents and maintain low temperature

  • If no: Proceed to next step

• Is aggregation occurring during storage?

  • If yes: Add 10-20% glycerol; store at -80°C; avoid freeze-thaw cycles

  • If no: Review buffer composition for potential incompatibilities

How can researchers validate the functionality of recombinant G. hirsutum Oleosin 18.2 kDa compared to the native protein?

Functional Validation Approaches:

• Structural Comparison:

  • Circular dichroism (CD) spectroscopy to compare secondary structure profiles

  • Limited proteolysis patterns to assess domain folding

  • Intrinsic fluorescence to evaluate tertiary structure

• Oil Body Association Assays:

  • In vitro reconstitution with TAG and phospholipids

  • Measure size distribution and stability of artificial oil bodies

  • Compare with oil bodies isolated from native cotton seeds

• Complementation Studies:

  • Express recombinant protein in oleosin knockout mutants

  • Assess rescue of phenotypes (oil body morphology, germination timing)

  • Quantify oil content restoration

Validation Metrics and Standards:

These validation approaches ensure that the recombinant protein accurately represents the native oleosin in both structural and functional aspects, which is critical for meaningful research outcomes.