Recombinant Gossypium hirsutum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Photosynthesis Studies

The recombinant protein is used to investigate:

  • Electron Transport Efficiency: Mutational studies to pinpoint residues affecting Q<sub>B</sub> binding and herbicide resistance .

  • Hybrid Vigor (Heterosis): Interspecific hybrids (e.g., G. hirsutum × G. barbadense) show upregulated Photosystem II genes (e.g., psbA), correlating with enhanced biomass and photosynthetic output .

Chloroplast Development

Studies on cotton and Arabidopsis reveal that splicing factors (e.g., GhCRS2, GhWTF1) interact with D1-related proteins to regulate chloroplast RNA maturation. Disruption of these factors impairs Photosystem II assembly and reduces chlorophyll content .

Comparative Analysis with G. barbadense Homolog

The G. barbadense Photosystem Q(B) protein (UniProt ID: A0ZZ15) shares 98% sequence identity with G. hirsutum but differs in expression patterns:

  • Hybrid Performance: G. hirsutum × G. barbadense hybrids exhibit transgressive upregulation of Photosystem II genes (e.g., psbW, PNSL2) but downregulation of Photosystem I genes (e.g., PSAF), optimizing light-use efficiency .

Key Research Findings

Study FocusOutcomeCitation
Heterosis MechanismsUpregulated Photosystem II genes in hybrids enhance biomass by 20–30% compared to parents.
Splicing Factor RolesGhCTSF1 interacts with GhCRS2/WTF1 to splice rpoC1 and ycf3, vital for chloroplast function.
Recombinant Protein UseEnables herbicide-binding assays and structural studies of Photosystem II.

Practical Considerations

  • Reconstitution: Dissolve in Tris/PBS buffer (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Avoid Repeated Thawing: Aliquot to prevent degradation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Database Links

KEGG: ghi:3989229

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the Photosystem Q(B) protein function in photosynthesis?

The Photosystem Q(B) protein functions as a critical electron transfer component within Photosystem II. It contains the binding site for plastoquinone at the QB position, which facilitates electron transfer from QA to the plastoquinone pool during the light-dependent reactions of photosynthesis. This electron transfer is essential for generating the proton gradient that drives ATP synthesis.

Disruption of photosynthetic proteins, including those in Photosystem II, leads to impaired chloroplast development and decreased photosynthetic efficiency . Studies of photosynthetic efficiency in cotton show that structural integrity of chloroplasts and proper function of photosynthetic proteins are essential for maintaining optimal quantum yield of PSI, electron transport rate, and non-photochemical quenching . When key photosynthetic proteins are compromised, chloroplast formation is altered, resulting in reduced thylakoid development and decreased plastoglobule formation .

Where is the Photosystem Q(B) protein localized in cotton cells?

The Photosystem Q(B) protein is specifically localized in the thylakoid membrane of chloroplasts in Gossypium hirsutum cells . This localization aligns with its function in photosynthesis, as the thylakoid membrane is the primary site of the light-dependent reactions.

Similar to other photosynthetic proteins in cotton, the chloroplast localization of photosynthetic components can be experimentally verified through transient expression studies using GFP fusion proteins. For example, research on other cotton photosynthetic proteins has demonstrated that when expressing empty vector controls (35S::GFP), green fluorescent protein is detected throughout the cell, while proteins specific to photosynthesis show exclusive chloroplast localization when fused with GFP .

What are the conserved domains in Photosystem Q(B) protein?

The Photosystem Q(B) protein contains several conserved domains that are critical for its function in electron transfer during photosynthesis. While not all domains are explicitly detailed in the research, the amino acid sequence revealed in the recombinant protein characterization indicates the presence of multiple transmembrane helices and binding sites for cofactors involved in electron transfer .

Drawing comparisons with other photosynthetic proteins in cotton, we can infer that the Photosystem Q(B) protein likely contains redox-active sites that participate in electron transfer reactions. For instance, other photosynthetic proteins in cotton, such as GhSBPase, contain conserved cysteine residues and motifs involved in redox regulation . Similar conservation patterns would be expected in the Photosystem Q(B) protein, particularly in regions involved in quinone binding and electron transfer.

How is the gene encoding Photosystem Q(B) protein expressed in different cotton tissues?

While specific expression patterns of the psbA gene encoding Photosystem Q(B) protein are not directly addressed in the search results, we can infer its expression pattern based on similar photosynthetic proteins in cotton. Photosynthetic genes in cotton typically show tissue-specific expression patterns, with highest expression in leaves, which are the main sites of photosynthesis.

For example, research on the GhSBPase gene, which encodes another key photosynthetic enzyme, demonstrated that its "highest expression level was in the leaves, which were also the main location of photosynthesis, and the expression level was very low or absent in the stems, roots, petals, fibers, and boll shells" . Additionally, studies comparing wild-type and yellow-green leaf mutant cotton plants showed reduced expression of photosynthetic genes in the mutants, correlating with lower photosynthetic rates . It is reasonable to expect that the psbA gene would follow a similar tissue-specific expression pattern, with predominant expression in photosynthetically active tissues.

What techniques are most effective for isolating and purifying recombinant Photosystem Q(B) protein?

For effective isolation and purification of recombinant Photosystem Q(B) protein, several specialized techniques are recommended based on current research protocols. The recombinant protein is typically produced with an affinity tag, though the specific tag type is determined during the production process to optimize purification efficiency .

A comprehensive purification protocol would include:

  • Expression in a suitable host system (bacterial, yeast, or insect cells)

  • Cell lysis under conditions that preserve protein structure

  • Affinity chromatography using the appropriate resin based on the tag used

  • Buffer exchange to a Tris-based buffer with 50% glycerol for optimal stability

  • Quality control testing for purity and activity

For storage considerations, the purified protein should be maintained at -20°C or -80°C for extended storage periods . Research indicates that repeated freezing and thawing significantly reduces protein stability and function, so working aliquots should be stored at 4°C and used within one week . These careful storage protocols ensure that the protein maintains its structural integrity and functional activity for experimental applications.

What methods can be used to study Photosystem Q(B) protein function in vivo?

Several sophisticated experimental approaches can be employed to study the function of Photosystem Q(B) protein in vivo, based on methodologies used for other photosynthetic proteins in cotton:

  • Gene silencing techniques: Virus-induced gene silencing (VIGS) has been successfully used to suppress expression of photosynthetic genes in cotton. This approach can be adapted to study Photosystem Q(B) protein by designing gene-specific fragments (approximately 300 bp) of the psbA gene for insertion into vectors like pCLCrV-A . The resulting phenotypes can provide insights into protein function.

  • CRISPR-Cas9 gene editing: This technology has been effectively applied to disrupt genes encoding photosynthetic proteins in cotton, allowing researchers to study the effects of protein loss on chloroplast development and photosynthesis .

  • Chlorophyll fluorescence measurements: Parameters such as quantum yield of PSI (ΦPSI), electron transport rate, and non-photochemical quenching (NPQ) can be measured to evaluate the functional impact of Photosystem Q(B) protein modifications . These parameters provide quantitative assessments of photosynthetic efficiency.

  • Transmission electron microscopy (TEM): This technique allows visualization of chloroplast ultrastructure, enabling researchers to observe how disruption of photosynthetic proteins affects thylakoid development and organization .

  • Correlation analysis: Establishing correlations between gene expression levels and physiological parameters, such as chlorophyll fluorescence measurements, can provide insights into the functional significance of photosynthetic proteins .

How can researchers measure activity of recombinant Photosystem Q(B) protein?

While specific activity assays for recombinant Photosystem Q(B) protein are not directly addressed in the search results, several methodological approaches can be inferred based on its function and research on related photosynthetic proteins:

  • Electron transfer assays: Since the Photosystem Q(B) protein is involved in electron transfer within Photosystem II, researchers can use artificial electron donors and acceptors to measure electron transfer rates in reconstituted systems containing the recombinant protein.

  • Binding studies with quinone analogs: Researchers can assess the binding affinity and kinetics of plastoquinone or quinone analogs to the recombinant protein using techniques such as isothermal titration calorimetry or fluorescence quenching.

  • Functional reconstitution: The recombinant protein can be incorporated into liposomes or nanodiscs to recreate a membrane environment, allowing for functional studies that more closely mimic the native context.

  • Photochemical activity measurements: Using specialized spectroscopic techniques, researchers can measure light-induced electron transfer events mediated by the recombinant protein.

  • Redox potential measurements: Determining the redox properties of the protein can provide insights into its electron transfer capabilities.

For these analyses, researchers should consider the storage conditions recommended for the recombinant protein (Tris-based buffer with 50% glycerol) to maintain protein stability during experimental procedures .

What techniques can reveal protein-protein interactions involving Photosystem Q(B)?

Several advanced techniques can be employed to investigate protein-protein interactions involving Photosystem Q(B) protein:

  • Co-immunoprecipitation (Co-IP): This technique can identify proteins that physically interact with Photosystem Q(B) protein in vivo. Using antibodies specific to the target protein, researchers can isolate protein complexes from plant extracts and identify interaction partners through mass spectrometry analysis.

  • Yeast two-hybrid (Y2H) assays: While challenging for membrane proteins, modified Y2H systems can be used to screen for potential interaction partners of specific domains of the Photosystem Q(B) protein.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique has been successfully used to analyze the accumulation of photosynthetic complexes in cotton . It allows separation of intact protein complexes under native conditions, providing insights into how Photosystem Q(B) protein assembles with other components of Photosystem II.

  • Pull-down assays with recombinant proteins: Using purified recombinant Photosystem Q(B) protein , researchers can perform pull-down assays to identify interaction partners from plant extracts.

  • Bimolecular fluorescence complementation (BiFC): This in vivo technique allows visualization of protein-protein interactions in plant cells by reconstituting a fluorescent protein when two proteins of interest interact.

When designing interaction studies, researchers should consider the membrane-embedded nature of Photosystem Q(B) protein and use approaches that accommodate its hydrophobic properties.

How can chlorophyll fluorescence be used to assess Photosystem Q(B) function?

Chlorophyll fluorescence measurements provide valuable insights into Photosystem II function, including the activity of Photosystem Q(B) protein. Several parameters can be specifically analyzed:

  • Quantum yield of PSI (ΦPSI): Research on photosynthetic proteins in cotton has shown that disruption of key components results in significantly lower quantum yield of PSI compared to wild-type plants . This parameter reflects the efficiency of light energy conversion in Photosystem I, which is indirectly affected by Photosystem II function.

  • Electron transport rate: Studies have demonstrated that silencing of photosynthetic genes in cotton leads to reduced electron transport rates . This parameter directly reflects the efficiency of electron flow through the photosynthetic electron transport chain, including the Q(B) site.

  • Non-photochemical quenching (NPQ): This parameter measures the ability of plants to dissipate excess light energy as heat. Research has shown that manipulation of Photosystem II components affects NPQ values .

  • Photochemical quenching coefficient (qP): Research on cotton photosynthetic genes has established positive correlations between gene expression levels and qP values . This parameter reflects photosynthetic activity levels and can indicate the functional status of Photosystem II.

Research has demonstrated that "the expression level of [photosynthetic genes] was positively correlated with chlorophyll fluorescence parameter qP" , suggesting that proper expression of photosynthetic proteins, including Photosystem Q(B), is essential for maintaining optimal photosynthetic efficiency.

How does environmental stress affect Photosystem Q(B) protein function?

Environmental stresses significantly impact photosynthetic proteins in cotton, including components of Photosystem II. While direct effects on Photosystem Q(B) protein are not explicitly detailed in the search results, research on other photosynthetic proteins provides insights into likely responses:

  • Drought stress response: Analysis of photosynthetic genes in cotton has identified drought-responsive cis-acting elements (MBS) in their promoters . These elements likely regulate gene expression under water-limited conditions, suggesting that Photosystem Q(B) protein levels may be modulated during drought.

  • Temperature stress effects: Studies have demonstrated that both high and low-temperature stress affect the expression patterns of photosynthetic genes in cotton . These temperature extremes likely impact the stability and function of Photosystem Q(B) protein.

  • Salt stress impact: Research has identified salicylic acid-responsive elements (TCA-elements) in the promoters of photosynthetic genes , suggesting that salt stress may trigger signaling pathways that alter gene expression.

  • Light stress adaptation: The presence of numerous light-responsive cis-acting elements (21 identified in one photosynthetic gene promoter) indicates sophisticated light-regulated expression of photosynthetic proteins . These elements likely fine-tune Photosystem Q(B) protein levels in response to changing light conditions.

Understanding these stress responses is critical for developing cotton varieties with enhanced stress tolerance, as modulation of photosynthetic proteins, including Photosystem Q(B), plays a key role in plant adaptation to adverse environmental conditions.

What mutations in Photosystem Q(B) protein affect photosynthetic efficiency?

While specific mutations in cotton Photosystem Q(B) protein are not directly addressed in the search results, we can infer potential effects based on research on photosynthetic machinery disruption:

Disruption of photosynthetic proteins in cotton leads to several observable phenotypes that would likely apply to Photosystem Q(B) protein mutations:

  • Yellow-variegated leaf phenotype: Research has shown that silencing of genes involved in photosynthesis results in yellow-variegated leaves , suggesting that Photosystem Q(B) mutations would similarly affect leaf pigmentation.

  • Reduced chlorophyll content: Studies demonstrate that disruption of photosynthetic components significantly reduces chlorophyll a and b content . Mutations in Photosystem Q(B) protein would likely cause similar reductions.

  • Altered chloroplast ultrastructure: Transmission electron microscopy has revealed that disruption of photosynthetic proteins results in abnormal chloroplast development, with poorly formed thylakoid membranes and absence of plastoglobules . As a core thylakoid protein, Photosystem Q(B) mutations would severely impact thylakoid organization.

  • Impaired photosynthetic parameters: Research shows that photosynthetic protein disruption reduces quantum yield of PSI, electron transport rate, and non-photochemical quenching . Given the central role of Photosystem Q(B) in electron transfer, mutations would significantly impact these parameters.

  • Reduced accumulation of photosynthetic complexes: Studies using blue native polyacrylamide gel electrophoresis have demonstrated reduced assembly of photosynthetic complexes when key components are disrupted .

How does Photosystem Q(B) protein interact with other components of the photosynthetic apparatus?

Photosystem Q(B) protein interacts with multiple components of the photosynthetic apparatus to facilitate electron transfer and maintain photosynthetic efficiency. While specific interaction partners in cotton are not directly detailed in the search results, several important interactions can be inferred based on the protein's function and research on photosynthetic complexes:

  • Interactions within Photosystem II: As a core component of Photosystem II, Photosystem Q(B) protein (D1) forms a heterodimer with the D2 protein and associates with numerous other subunits to form the functional complex.

  • Binding of electron transfer cofactors: The protein binds several cofactors essential for electron transfer, including chlorophyll molecules, pheophytin, and plastoquinone at the QB binding site.

  • Assembly with light-harvesting complexes: Research on photosynthetic complexes suggests that Photosystem Q(B) protein interacts with light-harvesting complex proteins to facilitate energy transfer from these antenna complexes to the reaction center.

  • Association with repair mechanisms: Due to its susceptibility to photodamage, Photosystem Q(B) protein interacts with components of the PSII repair machinery, including proteases and assembly factors.

Research techniques such as blue native polyacrylamide gel electrophoresis (BN-PAGE) have been used to analyze the accumulation of photosynthetic complexes in cotton and could be applied to investigate how Photosystem Q(B) protein assembles with other components of the photosynthetic apparatus.

How can gene editing technologies be applied to study Photosystem Q(B) function?

Gene editing technologies offer powerful approaches for investigating Photosystem Q(B) protein function in cotton. Based on methodologies successfully applied to other photosynthetic proteins, several approaches can be implemented:

  • CRISPR-Cas9 gene editing: This technology has been effectively used to disrupt genes encoding photosynthetic proteins in cotton . For studying Photosystem Q(B) protein, researchers could:

    • Design guide RNAs targeting specific regions of the psbA gene

    • Introduce precise mutations to assess the function of specific domains

    • Create conditional knockouts to study essential functions

  • Virus-induced gene silencing (VIGS): Research has demonstrated successful silencing of photosynthetic genes in cotton using this approach . Implementation involves:

    • Cloning gene-specific fragments (approximately 300 bp) of the psbA gene

    • Inserting these fragments into vectors like pCLCrV-A

    • Inoculating cotton plants and analyzing resulting phenotypes

  • Analysis of edited plants: After gene modification, comprehensive phenotypic analysis should include:

    • Chlorophyll content measurement

    • Transmission electron microscopy to assess chloroplast ultrastructure

    • Chlorophyll fluorescence parameters to evaluate photosynthetic efficiency

    • Blue native polyacrylamide gel electrophoresis to analyze complex assembly

  • Complementation studies: To confirm gene function, researchers can complement gene-edited plants with:

    • Wild-type psbA gene

    • Modified versions containing specific mutations

    • Orthologous genes from other species

These approaches provide a powerful toolkit for dissecting the function of Photosystem Q(B) protein and understanding its role in cotton photosynthesis.

How can manipulation of Photosystem Q(B) protein improve photosynthetic efficiency in cotton?

Strategic manipulation of Photosystem Q(B) protein could potentially enhance photosynthetic efficiency in cotton through several mechanisms:

What are the most promising areas for future research on Gossypium hirsutum Photosystem Q(B) protein?

Several promising research directions could advance our understanding of Photosystem Q(B) protein in cotton:

  • Structure-function relationship studies: Detailed structural analysis of the cotton Photosystem Q(B) protein would provide insights into how its unique features contribute to photosynthetic efficiency under various environmental conditions.

  • Genetic diversity exploration: Examining natural variation in the psbA gene across different cotton varieties could identify superior variants with enhanced stability or function that could be introduced into commercial varieties.

  • Environmental stress adaptation mechanisms: Investigating how Photosystem Q(B) protein responds to environmental stresses at the molecular level could inform strategies for developing stress-tolerant cotton varieties.

  • Interaction with regulatory networks: Exploring how the expression and function of Photosystem Q(B) protein are integrated with broader signaling networks would provide a systems-level understanding of photosynthetic regulation in cotton.

  • Biotechnological applications: Developing novel applications based on the electron transfer properties of Photosystem Q(B) protein, such as biosensors or bioenergy systems.

Research has demonstrated that photosynthetic proteins in cotton contain numerous regulatory elements responsive to environmental conditions , suggesting that Photosystem Q(B) protein likely plays a role in adaptive responses that could be leveraged for crop improvement.

How can comparative studies across species inform Photosystem Q(B) research in cotton?

Comparative studies of Photosystem Q(B) protein across different plant species can provide valuable insights applicable to cotton research:

  • Evolutionary adaptations identification: Comparing sequences from plants adapted to different environments could reveal naturally evolved modifications that enhance protein performance under specific conditions. These adaptations could inform targeted modifications in cotton.

  • Functional conservation assessment: Research has shown that orthologous photosynthetic proteins across species often maintain conserved functions . Identifying these conserved features in Photosystem Q(B) protein would highlight critical domains that should be preserved in engineering efforts.

  • Novel function discovery: Some species may have evolved unique features in their Photosystem Q(B) proteins that confer advantages under specific conditions. These features could be transferred to cotton through precision engineering.

  • Regulatory mechanism comparison: Examining how different plants regulate the expression and function of Photosystem Q(B) protein could reveal alternative regulatory strategies that might be applied in cotton.

  • Stress tolerance mechanisms: Species naturally adapted to extreme environments may possess Photosystem Q(B) variants with enhanced stability under stress. These variants could inform the development of stress-tolerant cotton varieties.

Studies have demonstrated that orthologous photosynthetic proteins in cotton and Arabidopsis can have similar functions despite differences in their sequences , suggesting that insights from model organisms can be successfully applied to cotton research.

What are the implications of Photosystem Q(B) research for sustainable agriculture?

Research on Photosystem Q(B) protein has significant implications for sustainable agriculture, particularly in cotton production:

  • Enhanced water use efficiency: Studies on photosystem components have demonstrated that their manipulation can affect water loss per CO₂ assimilated . Similar approaches focusing on Photosystem Q(B) protein could contribute to developing cotton varieties with improved drought tolerance.

  • Increased photosynthetic efficiency: Research has established correlations between expression of photosynthetic genes and parameters reflecting photosynthetic efficiency . Optimizing Photosystem Q(B) protein function could enhance carbon assimilation and yield potential.

  • Improved stress resilience: Studies have identified stress-responsive elements in the promoters of photosynthetic genes , suggesting that Photosystem Q(B) protein is likely involved in stress adaptation. Engineering enhanced stress tolerance could reduce yield losses under challenging conditions.

  • Reduced input requirements: Cotton varieties with improved photosynthetic efficiency may require fewer inputs, reducing the environmental footprint of cotton production.

  • Climate change adaptation: As climate conditions become more variable, cotton varieties with optimized photosynthetic machinery will be increasingly important for maintaining productivity.

These advancements align with sustainable agriculture goals by contributing to resource efficiency, environmental protection, and economic viability of cotton production in the face of climate change and resource limitations.

How might advances in structural biology enhance our understanding of Photosystem Q(B)?

Advanced structural biology techniques could significantly enhance our understanding of cotton Photosystem Q(B) protein:

  • High-resolution structure determination: Techniques such as cryo-electron microscopy or X-ray crystallography could reveal the precise three-dimensional arrangement of the protein within the Photosystem II complex, providing insights into how its structure facilitates function.

  • Conformational dynamics analysis: Methods like hydrogen-deuterium exchange mass spectrometry could elucidate the dynamic changes in protein structure that occur during electron transfer, providing a deeper understanding of the protein's mechanism.

  • Ligand binding site characterization: Detailed structural analysis could reveal the precise architecture of the QB binding pocket, informing rational design approaches to enhance plastoquinone binding and electron transfer efficiency.

  • Interface mapping with interaction partners: Structural studies could define the specific interfaces where Photosystem Q(B) protein interacts with other components of Photosystem II, providing targets for engineering improved complex assembly.

  • Comparison of stress-induced structural changes: Structural studies under various stress conditions could reveal how environmental factors affect protein conformation and function, identifying potential targets for enhancing stress tolerance.

While the recombinant protein is available in quantities suitable for structural studies (50 μg) , researchers would need to optimize conditions for maintaining the protein's native conformation during structural analysis, particularly given its membrane-embedded nature.

What technological advances are needed to accelerate Photosystem Q(B) research?

Several technological advances would significantly accelerate research on Photosystem Q(B) protein in cotton:

  • Improved gene editing efficiency in cotton: While CRISPR-Cas9 has been successfully applied in cotton , further refinements to improve efficiency and precision would facilitate more sophisticated functional studies of the psbA gene.

  • Advanced imaging technologies: Development of super-resolution microscopy techniques optimized for chloroplast proteins would allow visualization of Photosystem Q(B) protein dynamics within the native thylakoid membrane environment.

  • High-throughput functional assays: Development of rapid screening methods to assess electron transfer efficiency would accelerate the evaluation of engineered Photosystem Q(B) variants.

  • Improved protein expression systems: Advanced systems for expression and purification of membrane proteins would facilitate structural and biochemical studies of Photosystem Q(B) protein.

  • Computational modeling advances: Enhanced algorithms for predicting protein-protein interactions and simulating electron transfer would aid in rational design approaches.

  • Field-based phenotyping technologies: Advanced phenotyping methods to assess photosynthetic efficiency under field conditions would bridge the gap between laboratory findings and agricultural applications.

These technological advances would complement existing research tools, such as chlorophyll fluorescence analysis and transmission electron microscopy , enabling more comprehensive investigation of Photosystem Q(B) protein function and applications in cotton improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.