Recombinant Gossypium hirsutum V-type proton ATPase 16 kDa proteolipid subunit (CVA16-2)

What is the molecular structure and sequence of CVA16-2?

CVA16-2 is a proteolipid subunit of the vacuolar H+-ATPase (V-ATPase) complex found in Gossypium hirsutum (Upland cotton). The protein consists of 165 amino acids with the following sequence: MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFA
EALALYGLIVGIILSSRAGQSRAE . The protein contains multiple transmembrane domains that anchor it within the membrane bilayer, forming part of the V0 domain of the V-ATPase complex which is responsible for proton translocation across cellular membranes.

How does CVA16-2 function within the V-ATPase complex?

CVA16-2 functions as an integral component of the V0 domain of the V-ATPase complex. Like other V-ATPase proteolipid subunits, it contains a buried glutamate residue that is essential for proton transport . The V-ATPase complex consists of two main domains: the cytoplasmic V1 domain that hydrolyzes ATP and the membrane-embedded V0 domain that channels protons. As part of the V0 domain, CVA16-2 contributes to the rotary mechanism that allows protons to pass through the membrane, creating electrochemical gradients critical for various cellular processes including stress response mechanisms in plants .

How is CVA16-2 expressed in different cotton tissues?

Based on studies of V-ATPase subunits in cotton, CVA16-2 appears to be constitutively expressed across various tissues including roots, stems, and leaves, with typically higher expression levels in stems compared to other organs . To investigate tissue-specific expression experimentally, researchers should:

• Collect different tissue samples (roots, stems, leaves, flowers, etc.) from cotton plants under normal growing conditions

• Extract total RNA using a plant RNA extraction kit

• Synthesize cDNA through reverse transcription

• Perform quantitative PCR using primers specific to CVA16-2

• Normalize expression data to appropriate reference genes (e.g., actin, ubiquitin)

• Analyze relative expression levels across different tissues

How does abiotic stress affect CVA16-2 expression?

Studies on V-ATPase subunits in cotton show differential expression patterns under various abiotic stresses. The following table summarizes typical expression responses based on research with the V-ATPase subunit A gene:

To study these patterns for CVA16-2 specifically, seedlings at the three-leaf stage should be subjected to these stress treatments, with leaf samples collected at multiple time points (2, 4, 6, 12, and 24 hours) for RNA extraction and qRT-PCR analysis .

Do different cotton cultivars show variation in CVA16-2 expression under stress?

Research on V-ATPase subunits indicates that expression levels often correlate with drought tolerance capacity among cotton cultivars. Drought-resistant cultivars typically show significantly higher expression of V-ATPase subunits under dehydration stress compared to drought-sensitive cultivars . This difference suggests that enhanced V-ATPase activity through increased expression of component subunits like CVA16-2 may contribute to improved stress tolerance mechanisms. To verify this pattern specifically for CVA16-2:

• Select multiple cotton cultivars with established differences in drought tolerance

• Grow seedlings under identical conditions until the three-leaf stage

• Apply controlled dehydration stress (e.g., 15% PEG treatment)

• Collect leaf samples at designated time points

• Perform qRT-PCR analysis of CVA16-2 expression

• Correlate expression levels with established drought tolerance rankings

How can researchers effectively silence CVA16-2 expression in cotton?

Virus-induced gene silencing (VIGS) provides an efficient method for functional analysis of CVA16-2 in cotton. The following protocol is recommended:

• Design gene-specific primers to amplify a 300-400 bp fragment of CVA16-2, incorporating appropriate restriction enzyme sites

• PCR-amplify the target fragment from cotton cDNA

• Clone the fragment into a TRV2 vector (e.g., using EcoRI and KpnI sites)

• Transform the recombinant construct into Agrobacterium tumefaciens strain GV3101

• Grow transformed Agrobacterium in LB medium with appropriate antibiotics

• Infiltrate cotton seedlings at the cotyledon stage with a mixture of Agrobacterium containing pTRV1 and pTRV2-CVA16-2

• Include appropriate controls: wild-type plants, empty vector controls, and positive silencing controls (e.g., cotton CLA1 gene)

• Monitor phenotypic changes starting 2 weeks after infiltration

• Confirm silencing efficiency using qRT-PCR analysis of CVA16-2 expression

Successful silencing can be identified by the appearance of photobleaching in CLA1-silenced plants, which serves as a visual marker for VIGS efficiency .

What phenotypic analyses are most informative when studying CVA16-2 function?

When investigating CVA16-2 function through gene silencing or overexpression, several phenotypic analyses provide valuable insights:

• Water loss assessment: Measure water loss rates in detached leaves by weighing leaves at regular intervals under controlled conditions

• Drought stress response: Subject plants to water withholding (15 days) or PEG treatment (15-20% PEG for 24 hours) and assess:

  • Leaf wilting and plant survival rates

  • Relative water content of leaves

  • Electrolyte leakage as an indicator of membrane integrity

  • Photosynthetic parameters (using a portable photosynthesis system)

• Biochemical markers: Measure stress-related metabolites and enzyme activities:

  • Proline accumulation

  • Malondialdehyde (MDA) content as an indicator of lipid peroxidation

  • Antioxidant enzyme activities (SOD, CAT, APX)

• Gene expression analysis: Examine expression of known drought-responsive genes to assess downstream effects

These analyses should be performed comparatively between experimental plants (silenced or overexpressing CVA16-2) and appropriate controls.

How can researchers generate transgenic plants overexpressing CVA16-2?

For gain-of-function studies, researchers can generate transgenic plants overexpressing CVA16-2 following this methodology:

• Amplify the full-length CVA16-2 coding sequence using specific primers containing appropriate restriction sites (e.g., SpeI and NcoI)

• Clone the coding region into an expression vector (e.g., pCAMBIA1304) downstream of a constitutive promoter like CaMV35S

• Transform the construct into Agrobacterium tumefaciens strain EHA105

• Transform model plants such as tobacco (Nicotiana tabacum) using the leaf disk transformation method:

  • Sterilize leaf disks and co-cultivate with transformed Agrobacterium

  • Transfer to selection medium containing appropriate antibiotics

  • Regenerate shoots and roots on hormone-supplemented media

  • Transfer rooted plantlets to soil for acclimatization

• Confirm transgene integration by PCR and expression levels by qRT-PCR and Western blotting

• Perform phenotypic and molecular analyses to assess the effects of CVA16-2 overexpression on stress tolerance

This approach can determine whether enhanced expression of CVA16-2 alone is sufficient to improve drought tolerance, providing valuable insights into its functional significance.

What expression systems are optimal for producing recombinant CVA16-2?

Several expression systems can be employed for recombinant CVA16-2 production, each with distinct advantages:

What challenges are specific to purifying membrane proteins like CVA16-2?

Purifying membrane proteins such as CVA16-2 presents several challenges that require specific strategies:

• Solubilization: Use appropriate detergents (DDM, digitonin, or CHAPS) at concentrations above their critical micelle concentration

• Protein stability: Include glycerol (10-20%) and protease inhibitors in all buffers

• Purification strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged protein

  • Stringent washing with low imidazole concentrations (10-40 mM) to remove non-specific binding

  • Elution with 250-300 mM imidazole

  • Size exclusion chromatography for further purification

• Quality assessment:

  • SDS-PAGE analysis with Coomassie staining

  • Western blotting with anti-His antibodies

  • Mass spectrometry for identity confirmation

  • Circular dichroism to verify secondary structure

Maintaining detergent concentrations above critical micelle concentration throughout purification is essential to prevent protein aggregation.

How can researchers assay the functional activity of purified CVA16-2?

Assessing the functional activity of purified CVA16-2 requires reconstitution into a membrane environment:

• Liposome reconstitution:

  • Prepare liposomes using lipids that mimic the native membrane environment (phosphatidylcholine, phosphatidylethanolamine)

  • Incorporate purified CVA16-2 using detergent removal methods (dialysis, Bio-Beads)

  • Verify incorporation by density gradient centrifugation

• Proton transport assays:

  • Load liposomes with pH-sensitive fluorescent dyes (ACMA, pyranine)

  • Establish a pH gradient across the liposome membrane

  • Monitor fluorescence changes indicating proton movement

  • Test effects of specific inhibitors (bafilomycin, concanamycin)

• Proteoliposome ATPase activity:

  • If reconstituted with other V-ATPase components, measure ATP hydrolysis

  • Use colorimetric assays (malachite green) to detect released phosphate

  • Compare activity rates with and without proton gradient uncouplers

These functional assays should be performed alongside appropriate controls, including liposomes without protein and liposomes with known functional V-ATPase components .

How does CVA16-2 contribute to drought tolerance mechanisms?

As a component of the V-ATPase complex, CVA16-2 likely contributes to drought tolerance through several mechanisms:

• Vacuolar acidification: By facilitating proton transport into the vacuole, V-ATPase generates the electrochemical gradient necessary for secondary transporters that sequester ions and metabolites

• Osmotic adjustment: The electrochemical gradient drives accumulation of solutes in the vacuole, helping maintain cell turgor under water deficit

• Membrane trafficking: V-ATPase activity is essential for vesicle trafficking and membrane remodeling during stress responses

• Signaling pathway modulation: pH changes mediated by V-ATPase can influence stress signaling cascades

Evidence from studies with V-ATPase subunits shows that silencing these genes increases sensitivity to drought stress, manifested as severe wilting, accelerated water loss, and decreased survival under water deficit conditions . The differential expression of V-ATPase subunits in drought-resistant versus drought-sensitive cotton cultivars further supports their role in stress adaptation mechanisms.

What evidence links CVA16-2 expression to improved stress tolerance?

Several lines of evidence connect V-ATPase subunit expression, including proteins like CVA16-2, to enhanced stress tolerance:

• Differential expression patterns: V-ATPase subunits show upregulation in response to various abiotic stresses including dehydration, salinity, and low temperature

• Cultivar differences: Drought-resistant cotton cultivars exhibit higher expression levels of V-ATPase subunits under stress conditions compared to drought-sensitive cultivars

• Loss-of-function phenotypes: Silencing of V-ATPase genes through VIGS leads to increased drought sensitivity, with silenced plants showing more severe wilting and faster water loss than control plants

• Gain-of-function evidence: Transgenic plants overexpressing V-ATPase subunits demonstrate enhanced tolerance to water deficit, supporting their role in stress adaptation

To specifically confirm CVA16-2's role, researchers should conduct similar experiments focusing on this particular subunit, examining both loss-of-function and gain-of-function approaches across different stress conditions.

What molecular pathways interact with CVA16-2 during stress responses?

The molecular pathways involving CVA16-2 during stress responses likely include:

• ABA signaling pathway: The upregulation of V-ATPase subunits in response to ABA treatment suggests involvement in ABA-mediated stress responses . This pathway includes:

  • ABA receptors (PYR/PYL/RCAR proteins)

  • Protein phosphatases (PP2C)

  • SnRK2 kinases

  • AREB/ABF transcription factors

• Calcium signaling: Changes in cytosolic calcium levels during stress may regulate V-ATPase activity through:

  • Calcium sensors (calmodulin, CDPKs)

  • Phosphorylation events affecting V-ATPase assembly or activity

• ROS signaling: Reactive oxygen species generated during stress can influence V-ATPase function, while V-ATPase activity may affect cellular redox balance

• Osmotic stress response pathway: V-ATPase contributes to osmotic adjustment through:

  • Ion transporters (Na+/H+ antiporters, K+ channels)

  • Water channels (aquaporins)

  • Compatible solute biosynthesis pathways

To elucidate these interactions experimentally, researchers should employ approaches such as co-expression analysis, protein-protein interaction studies, and pharmacological inhibition of specific signaling components while monitoring CVA16-2 expression and V-ATPase activity.

What techniques can determine the membrane topology of CVA16-2?

Several complementary approaches can be employed to determine CVA16-2's membrane topology:

• Cysteine scanning mutagenesis:

  • Generate a cysteine-less version of CVA16-2 by replacing native cysteines

  • Introduce single cysteines at various positions throughout the protein

  • Probe accessibility using membrane-permeable (MPB) and membrane-impermeable (AMS) sulfhydryl reagents

  • Analyze labeling patterns to determine cytoplasmic versus luminal orientation

• Epitope tagging:

  • Insert epitope tags (HA, FLAG, etc.) at predicted loop regions or termini

  • Perform protease protection assays with intact membranes

  • Detect protected versus digested epitopes by Western blotting

• Computational prediction:

  • Use hydropathy analysis and topology prediction algorithms (TMHMM, Phobius)

  • Identify potential transmembrane segments and their orientation

  • Use these predictions to guide experimental design

• Comparative analysis:

  • Compare with experimentally determined topologies of homologous proteins

  • Identify conserved residues and structural features

These approaches, when used in combination, can provide a reliable model of CVA16-2's membrane topology.

How do transmembrane segments of CVA16-2 contribute to proton transport?

The transmembrane segments of V-ATPase proteolipid subunits like CVA16-2 play crucial roles in proton transport through specific structural features:

• Essential glutamate residue: Each proteolipid subunit contains a buried glutamate residue that is essential for proton transport, functioning as the proton binding site during the transport cycle

• Transmembrane helices arrangement: The helices form a ring structure creating a pathway for proton translocation across the membrane

• Helix-helix interactions: Specific interactions between transmembrane segments both within and between subunits are critical for maintaining the structural integrity of the proton channel

• Conformational changes: During the catalytic cycle, the transmembrane segments undergo conformational changes that facilitate proton movement from one side of the membrane to the other

What evolutionary insights can be gained from comparing CVA16-2 with homologs across species?

Comparative analysis of CVA16-2 with homologs across species can reveal:

• Conserved functional domains: Identification of highly conserved regions likely essential for function, particularly:

  • The glutamate residue involved in proton binding

  • Interface regions for subunit interactions

  • Regions involved in coupling rotation to proton transport

• Evolutionary adaptations: Species-specific variations that may reflect adaptation to different cellular environments or stress conditions

• Structural diversity: Different organisms have varying numbers and types of proteolipid subunits (e.g., yeast has three distinct subunits: c, c', and c" ), which may reflect functional specialization

• Plant-specific features: Features unique to plant V-ATPase proteolipids that may relate to their role in stress responses

• Perform multiple sequence alignment of proteolipid subunits from diverse species

• Calculate sequence conservation scores for each position

• Map conservation data onto structural models

• Identify sites under positive selection using appropriate evolutionary models

This approach can provide insights into both the fundamental mechanisms of V-ATPase function and the specialized roles of CVA16-2 in cotton.

How can knowledge of CVA16-2 function be applied to developing drought-tolerant cotton varieties?

Understanding CVA16-2's role in drought tolerance can inform several approaches to crop improvement:

• Marker-assisted selection:

  • Develop molecular markers associated with favorable CVA16-2 alleles

  • Screen germplasm collections for these markers

  • Incorporate identified alleles into elite breeding lines

• Genetic engineering:

  • Develop transgenic cotton overexpressing CVA16-2 under constitutive or stress-inducible promoters

  • Use CRISPR/Cas9 genome editing to enhance promoter activity or optimize coding sequence

• Expression modulation strategies:

  • Identify and apply elicitors or agrochemicals that enhance CVA16-2 expression

  • Develop RNA interference approaches targeting negative regulators of CVA16-2

• Physiological screening methods:

  • Develop high-throughput assays for V-ATPase activity as a proxy for drought tolerance

  • Use these assays to screen breeding populations

These approaches should be evaluated not only for drought tolerance but also for potential trade-offs with yield, fiber quality, and other agronomically important traits .

What potential interactions between CVA16-2 and other stress response genes should be investigated?

To fully understand CVA16-2's role in stress adaptation, several key interactions should be investigated:

• Other V-ATPase subunits: Examine coordinated expression and assembly with other components of the V-ATPase complex during stress

• Ion transporters:

  • Na+/H+ antiporters (NHX family)

  • K+ transporters

  • Ca2+ transporters
    These systems rely on the proton gradient established by V-ATPase

• Aquaporins: Water channel proteins that facilitate water movement across membranes and may work in concert with V-ATPase-mediated osmotic adjustment

• Stress signaling components:

  • ABA biosynthesis and signaling elements

  • MAP kinase cascade components

  • Transcription factors (DREB, AREB, NAC family)

• Antioxidant systems: Enzymes and metabolites involved in ROS scavenging that protect cellular components during stress

Investigating these interactions would provide a more comprehensive understanding of how CVA16-2 functions within the broader stress response network, potentially identifying synergistic combinations for crop improvement.

What high-throughput methods can assess CVA16-2 function in diverse cotton germplasm?

Several high-throughput approaches can assess CVA16-2 function across diverse cotton germplasm:

• Genomic screening:

  • Targeted sequencing of CVA16-2 loci across cotton accessions

  • Identification of haplotypes correlated with drought tolerance

  • Development of allele-specific markers for breeding

• Transcriptomic analysis:

  • RNA-seq under normal and stress conditions

  • Quantification of CVA16-2 expression levels and patterns

  • Correlation with stress tolerance phenotypes

• Protein-level assessment:

  • Antibody-based detection of CVA16-2 protein levels

  • Enzyme activity assays for V-ATPase function

  • Proteomics approaches to assess V-ATPase complex assembly

• Phenotypic platforms:

  • Automated imaging systems to capture drought stress responses

  • Physiological measurements (photosynthesis, transpiration)

  • Root system architecture analysis

• Metabolomic screening:

  • Profiling of osmolytes and stress-related metabolites

  • Correlation with CVA16-2 expression levels

These approaches can be integrated through bioinformatic analysis to identify relationships between genetic variation in CVA16-2, its expression and function, and drought tolerance phenotypes across diverse cotton germplasm.