Recombinant Gracilaria tenuistipitata var. liui Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Grc000124; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-310
Protein Length
Full Length of Mature Protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
petA
Target Protein Sequence
FPIYAQQGYENPREATGRIVCANCHLAQKPIKIEAPKTVLPNSIFEAIVKIPYDTNNKQL LGNGIKGSINTGAVMILPEGFKLAPKNLLSEELREKTKNVYIQPYSTTKDNILLVGPLAG EKNQEIIFPILSPDPSKDKNIHFLKYPIYIGANRGRGQVYPTGDKSNNNPIVSLNTGKVT KIISLEKGGYKIEIEKDNGEIYTENIPQGLNLMVSQGSQVVANQNLTDDPNVGGFGQTEI EIVLQSPSRIKGMIVFFFTVTIAQIFFVLKKKQWEKVQAAEINF
Uniprot No.

Target Background

Function
Recombinant *Gracilaria tenuistipitata* var. *liui* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what role does it play in Gracilaria tenuistipitata var. liui?

Apocytochrome f is a critical component of the photosynthetic electron transport chain in the red alga Gracilaria tenuistipitata var. liui. It is encoded by the petA gene located in the plastid genome, which spans 183,883 bp and contains 238 predicted genes . As part of the cytochrome b6f complex, Apocytochrome f functions as an electron carrier between photosystem II and photosystem I during photosynthesis. The protein plays a crucial role in energy transduction within the thylakoid membrane of chloroplasts, making it essential for the photosynthetic processes that support the algae's growth and metabolism .

How does Gracilaria tenuistipitata var. liui Apocytochrome f compare to those from other photosynthetic organisms?

Apocytochrome f from Gracilaria tenuistipitata var. liui shares significant structural and functional similarities with homologs from other red algae, but also exhibits unique features compared to those in green algae and higher plants. Phylogenetic analysis of a dataset of 41 concatenated proteins from 23 plastid and two cyanobacterial genomes supports red algal plastid monophyly and reveals a specific evolutionary relationship between the Florideophycidae (to which Gracilaria belongs) and the Bangiales .

The plastid genome of Gracilaria tenuistipitata var. liui maintains a surprisingly ancient gene content, and together with other Rhodophyta, contains one of the most complete repertoires of plastid genes known in photosynthetic eukaryotes . This makes the study of its Apocytochrome f particularly valuable for understanding plastid evolution.

What methodologies are most effective for expressing recombinant Gracilaria tenuistipitata var. liui Apocytochrome f in heterologous systems?

The expression of recombinant Gracilaria tenuistipitata var. liui Apocytochrome f requires careful consideration of several factors:

Expression Systems:

Key Methodological Considerations:

  • Codon Optimization: The GC content and codon usage of red algae differ from common expression hosts. Codon optimization is crucial for efficient expression.

  • Signal Peptide Modification: The chloroplast targeting sequence may need removal or replacement.

  • Heme Incorporation: Supplementation with δ-aminolevulinic acid may improve heme incorporation.

  • Solubility Enhancement: Fusion tags (His, GST, MBP) can improve solubility and facilitate purification.

For optimal activity, recombinant Apocytochrome f must incorporate the heme group correctly. This often requires co-expression of cytochrome c maturation (Ccm) proteins in bacterial systems to achieve proper covalent attachment of the heme to the CXXCH motif .

How can researchers effectively analyze the redox properties of recombinant Gracilaria tenuistipitata var. liui Apocytochrome f?

Several electrochemical and spectroscopic techniques can be employed to characterize the redox properties of recombinant Apocytochrome f:

Methodological Approaches:

TechniqueParameters MeasuredAdvantagesLimitations
Cyclic VoltammetryMidpoint potential, electron transfer ratesReal-time monitoring, quantitative dataRequires electrode modification
UV-Vis SpectroscopyAbsorption spectra changes during reduction/oxidationSimple, non-destructiveLower sensitivity
EPR SpectroscopyParamagnetic species detectionHigh sensitivity to unpaired electronsComplex data interpretation
Potentiometric TitrationRedox potential determinationAccurate under equilibrium conditionsTime-consuming
Protein Film VoltammetryDirect electron transfer kineticsMeasures natural electron transfer ratesTechnical complexity

For comprehensive analysis, researchers should combine spectroscopic techniques with functional assays that measure electron transfer rates between Apocytochrome f and its physiological partners (e.g., plastocyanin or cytochrome c6).

What insights does the Gracilaria tenuistipitata var. liui plastid genome provide for understanding plastid evolution?

The complete plastid genome sequence of Gracilaria tenuistipitata var. liui provides significant insights into plastid evolution:

  • Ancient Gene Content: Gracilaria maintains a remarkably ancient gene content in its plastid genome, providing a window into early plastid evolution .

  • Genomic Rearrangements: Despite strong conservation of gene content and order when compared with Porphyra purpurea (another red alga), major genomic rearrangements and Gracilaria-specific coding regions have been identified .

  • Evolutionary Relationships: Phylogenetic analysis supports red algal plastid monophyly and a specific evolutionary relationship between the Florideophycidae and the Bangiales .

  • Complete Gene Repertoire: Together with other Rhodophyta, Gracilaria contains the most complete repertoire of plastid genes known in photosynthetic eukaryotes .

  • Single rRNA Operon: The genome contains a single copy of the ribosomal RNA operon, which differs from some other algal groups .

The study of Apocytochrome f in this context provides a valuable marker for tracking evolutionary changes in photosynthetic machinery across diverse lineages of photosynthetic organisms.

How can recombinant Gracilaria tenuistipitata var. liui Apocytochrome f be used in studies of electron transport mechanisms?

Recombinant Apocytochrome f serves as an excellent model for investigating fundamental electron transport mechanisms:

Methodological Applications:

  • Reconstitution Studies: The purified protein can be incorporated into liposomes or nanodiscs with other components of the cytochrome b6f complex to study electron transport in a controlled environment.

  • Electron Transfer Kinetics: Laser flash photolysis coupled with time-resolved spectroscopy can measure electron transfer rates between Apocytochrome f and its electron donors/acceptors.

  • Protein-Protein Interaction Analysis: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can quantify binding affinities between Apocytochrome f and plastocyanin under varying conditions.

  • Site-Directed Mutagenesis: Systematic mutation of key residues can identify critical amino acids involved in electron transfer and protein-protein interactions.

  • Comparative Studies: Parallel analysis with Apocytochrome f from other species can reveal evolutionary adaptations in electron transport mechanisms.

These approaches provide insights into how structural features of Apocytochrome f contribute to efficient electron transport, which is essential for photosynthetic energy conversion.

What techniques are most effective for studying the structural dynamics of Gracilaria tenuistipitata var. liui Apocytochrome f?

Understanding the structural dynamics of Apocytochrome f requires a multi-technique approach:

Advanced Structural Analysis Methods:

  • X-ray Crystallography: Provides high-resolution static structures but requires successful crystallization of the protein.

  • Cryo-Electron Microscopy (Cryo-EM): Can visualize the protein in different conformational states, particularly valuable for membrane proteins.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps protein dynamics and solvent accessibility changes during function.

  • Nuclear Magnetic Resonance (NMR): Provides information on protein dynamics in solution, though challenging for larger proteins.

  • Molecular Dynamics Simulations: Computational approach that can model conformational changes during electron transfer events.

For optimal results, researchers should integrate data from multiple techniques. For example, combining a high-resolution crystal structure with HDX-MS data and molecular dynamics simulations can provide a comprehensive understanding of how Apocytochrome f changes conformation during electron transfer.

How does Apocytochrome f contribute to the unique photosynthetic properties of Gracilaria tenuistipitata var. liui?

Apocytochrome f plays a central role in the distinctive photosynthetic characteristics of Gracilaria tenuistipitata var. liui by facilitating electron transport under variable marine conditions:

  • Spectral Adaptation: Red algae like Gracilaria possess phycobiliproteins that allow them to harvest light at depths where green and blue wavelengths predominate. Apocytochrome f connects this unique light-harvesting system to ATP production .

  • Stress Response Integration: Under oxidative stress conditions, the electron transport chain involving Apocytochrome f must maintain efficiency while preventing excessive reactive oxygen species (ROS) formation. The antioxidant properties observed in Gracilaria extracts (including DPPH radical scavenging activity and protection against H₂O₂-induced DNA damage) may be related to mechanisms that protect the photosynthetic apparatus .

  • Salinity Adaptation: Marine algae like Gracilaria must adapt to fluctuating salinity levels. The electron transport chain, including Apocytochrome f, plays a crucial role in maintaining photosynthetic efficiency under varying ionic conditions.

Understanding these adaptations provides insights into how red algae have evolved to thrive in their specific ecological niches.

What insights does research on Gracilaria tenuistipitata var. liui Apocytochrome f provide for algal biotechnology applications?

Research on Apocytochrome f contributes to several biotechnology applications:

  • Optimized Photosynthesis: Understanding the structure-function relationship of Apocytochrome f could inform strategies to enhance photosynthetic efficiency in algal cultivation systems.

  • Stress Resistance: The study of how Apocytochrome f functions under stress conditions provides insights for developing more resilient algal strains for bioproduction.

  • Biofuel Production: Knowledge of electron transport chain components like Apocytochrome f is crucial for metabolic engineering approaches aimed at redirecting photosynthetic electrons toward biofuel precursor production.

  • Bioactive Compound Production: The anti-inflammatory and antioxidant properties of Gracilaria extracts (AEGT) have been demonstrated to inhibit inflammatory mediators like nitric oxide and prostaglandin E2, as well as proinflammatory cytokines including interleukin (IL)-1β, IL-6 and tumor necrosis factor-α . Understanding the relationship between photosynthetic efficiency and bioactive compound production could help optimize cultivation conditions.

The cross-disciplinary nature of this research connects fundamental photosynthesis research with applied biotechnology.

What are the common challenges in purifying active recombinant Gracilaria tenuistipitata var. liui Apocytochrome f and how can they be addressed?

Researchers face several challenges when purifying active recombinant Apocytochrome f:

Challenges and Solutions Table:

ChallengeCauseSolution Approaches
Low SolubilityMembrane protein characterUse mild detergents (DDM, LDAO); Truncate transmembrane domain; Optimize buffer conditions
Improper Heme IncorporationInefficient cytochrome maturationCo-express with cytochrome c maturation proteins; Supplement with δ-aminolevulinic acid
Protein AggregationHydrophobic interactionsAdd glycerol or arginine to buffers; Use controlled refolding procedures
Low Expression YieldCodon bias, toxicityOptimize codon usage; Use tightly regulated expression systems; Lower induction temperature
Protein InstabilityOxidation, proteolysisAdd reducing agents; Include protease inhibitors; Store under nitrogen atmosphere

A strategic approach combines careful construct design with optimized expression and purification conditions. For example, using a modified E. coli strain with enhanced disulfide bond formation capabilities and supplemented with a heme precursor has been successful for other cytochrome proteins.

How can researchers accurately assess the functional integrity of purified recombinant Gracilaria tenuistipitata var. liui Apocytochrome f?

Confirming the functional integrity of purified recombinant Apocytochrome f is essential for meaningful experimental results:

Methodological Validation Approaches:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to confirm characteristic absorption peaks at ~550 nm (reduced) and ~520 nm (oxidized)

    • Circular dichroism (CD) spectroscopy to verify secondary structure integrity

  • Redox Activity Assessment:

    • Cyclic voltammetry to determine if the midpoint redox potential matches expected values

    • Electron transfer assays with natural redox partners (plastocyanin or cytochrome c6)

  • Structural Validation:

    • Size-exclusion chromatography to confirm monomeric state

    • Dynamic light scattering to assess homogeneity

    • Limited proteolysis to verify proper folding

  • Heme Incorporation:

    • Pyridine hemochrome assay to quantify covalently bound heme

    • Heme-to-protein ratio calculation

  • Thermal Stability:

    • Differential scanning calorimetry to measure thermal denaturation

    • Thermal shift assays to assess stability in different buffer conditions

Researchers should employ multiple complementary techniques to comprehensively validate the functional integrity of the purified protein before proceeding with downstream applications.

What emerging techniques could advance our understanding of Gracilaria tenuistipitata var. liui Apocytochrome f function?

Several cutting-edge methodologies hold promise for deepening our understanding of Apocytochrome f:

  • Single-Molecule Techniques: Methods like single-molecule FRET could reveal conformational dynamics during electron transfer events at unprecedented resolution.

  • Time-Resolved Serial Crystallography: X-ray free-electron lasers (XFELs) could capture structural snapshots during the electron transfer process.

  • In-Cell NMR: Could provide insights into how Apocytochrome f behaves in a native-like environment.

  • Cryo-Electron Tomography: May reveal the spatial organization of Apocytochrome f within the thylakoid membrane architecture.

  • Integrative Structural Biology: Combining computational modeling with multiple experimental datasets could provide a more complete picture of Apocytochrome f dynamics.

  • CRISPR-Based Approaches: For in vivo studies, CRISPR technologies could enable precise engineering of the petA gene to study structure-function relationships in the native organism.

These emerging techniques could address longstanding questions about the precise mechanism of electron transfer and the dynamics of protein-protein interactions during photosynthesis.

How might comparative studies between Gracilaria tenuistipitata var. liui and other species inform our understanding of photosynthetic adaptations?

Comparative studies offer valuable insights into photosynthetic evolution and adaptation:

  • Cross-Species Comparison: Systematic comparison of Apocytochrome f from diverse photosynthetic organisms (cyanobacteria, red algae, green algae, and plants) could reveal how structural variations relate to ecological adaptations.

  • Environmental Adaptation Studies: Comparing Apocytochrome f from Gracilaria species adapted to different marine environments could identify molecular features that enable photosynthetic efficiency under various conditions.

  • Ancestral Sequence Reconstruction: Computational reconstruction of ancestral Apocytochrome f sequences could provide insights into the evolutionary trajectory of this protein.

  • Horizontal Gene Transfer Assessment: Investigation of potential horizontal gene transfer events involving the petA gene could reveal unexpected evolutionary relationships.

  • Structure-Function Correlation: Mapping structural differences to functional variations across species could identify critical regions for electron transfer efficiency.

Such comparative approaches could not only enhance our fundamental understanding of photosynthesis but also inform strategies for engineering more efficient photosynthetic systems for biotechnology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.