Recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b, chloroplastic (atpF) is a protein that can be produced through recombinant technology, which involves using genetically engineered cells to produce the protein of interest .
Key characteristics:
Alternative Names: ATP synthase F(0) sector subunit b, ATPase subunit I
AA Sequence: MDSCIQVFSVIANFDTDYNLSISFNTDFLEANVINILLLLLGLMYVLKEFLGSILVDRQE KVLLAIQESEERLKQANSRLSESEKQLAQTQMVIAQIIKEAETTAQKVRQSILDQGKADV DKLISASKASIATAEVQIKQQIQLQVTSLAIKRVTMQLQDQITPNIQTRIIDNNIAQLGG YL
ATP synthase is an enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency of cells, through chemiosmosis . ATP synthase uses the energy from a proton gradient to drive the synthesis of ATP . The ATP synthase subunit b is a crucial component of the F0 sector of the ATP synthase complex, which is embedded in the chloroplast membrane and facilitates proton translocation .
The complete plastid genome of Gracilaria tenuistipitata var. liui is a circular DNA molecule of 183,883 bp in length, with a GC content of 29.1% . The genome encodes a single copy of the ribosomal RNA operon and contains genes involved in the biosynthesis of amino acids, fatty acids, and components of the photosynthetic apparatus . The atpF gene, which encodes the ATP synthase subunit b, is present in this plastid genome . The plastid genomes of Gracilaria tenuistipitata var. liui and Grateloupia taiwanensis are similar in sequence and share significant synteny .
In photosynthesis, ATP is synthesized using phosphate, and the reduction of protein synthesis can affect the content of chlorophyll and other pigments in algal cells .
Sulfate deprivation can affect the metabolic processes and the abundance of transcripts related to sulfur metabolism in Gracilaria species, influencing the production of sulfur-containing metabolites .
Gracilaria tenuistipitata is an edible red seaweed that has attracted significant research interest due to its biological properties. This marine alga contains various bioactive compounds that exhibit antioxidant properties, including phenolics, flavonoids, and ascorbic acid . The significance of G. tenuistipitata extends beyond nutritional applications, as it shows potential for use in pharmaceutical and biomedical research owing to its ability to scavenge free radicals and protect against oxidative DNA damage . Studies have demonstrated that aqueous extracts of G. tenuistipitata (AEGT) can inhibit hydrogen peroxide-induced DNA damage in both plasmid DNA and human cells, making it a promising candidate for applications requiring antioxidant properties .
ATP synthase in chloroplasts plays a crucial role in energy production during photosynthesis. Specifically, the chloroplastic ATP synthase subunit b (atpF) is part of the F₀ complex that forms a proton channel across the thylakoid membrane. This subunit helps facilitate the flow of protons through the ATP synthase complex, which drives the catalytic synthesis of ATP from ADP and inorganic phosphate.
While the specific details of G. tenuistipitata's ATP synthase aren't extensively documented in the provided sources, research on ATP synthase in other organisms like Euglena gracilis has shown that structural variations in ATP synthase can be significant between species . These structural differences may contribute to unique functional adaptations in diverse photosynthetic organisms. In the case of G. tenuistipitata, understanding the structure and function of its ATP synthase components could provide insights into the organism's bioenergetic efficiency in various environmental conditions.
While specific structural information about Gracilaria tenuistipitata ATP synthase is limited in the provided sources, comparative analyses with other organisms can be informative. Research on Euglena gracilis has revealed that its ATP synthase structure is "fundamentally different" from other organisms . Using cryo-electron microscopy, researchers discovered that E. gracilis ATP synthase is larger than that found in yeast, with 13 of its 29 subunits being unique to the Euglenaceae family .
Based on available research, the Escherichia coli expression system has been successfully employed for recombinant expression of Gracilaria proteins. Studies with Gracilaria changii demonstrated successful cloning of open reading frames (ORFs) of several proteins into the pET28(+) expression vector and transformation into E. coli BL21 (DE3) pLysS strain .
For optimal expression of Gracilaria proteins:
Vector selection: pET28(+) has proven effective for Gracilaria protein expression
Host strain: E. coli BL21 (DE3) pLysS is compatible with Gracilaria gene expression
Expression conditions: Temperature optimization is crucial - some proteins express well at both 30°C and 37°C (like GcFBPA and GcGALE), while others may require lower temperatures (20°C) to prevent formation of inclusion bodies
Media: Auto-induction Luria Bertani medium has been used successfully for expression with 16-hour induction periods
It's worth noting that some proteins (like GcSMF in the referenced study) may express primarily in the insoluble fraction regardless of temperature conditions, which may necessitate optimization of solubilization and refolding protocols .
For effective protein extraction from Gracilaria species, the Trichloroacetic acid (TCA)-Phenol method has been demonstrated to be effective . This method is particularly suitable for extraction of total protein samples from Gracilaria species and has been utilized in research analyzing protein expression patterns.
The methodology involves:
Sample preparation: Fresh or frozen Gracilaria tissue is typically homogenized
Extraction reagents: TCA and phenol are used in combination to precipitate proteins and separate them from other cellular components
Quantification: Following extraction, protein concentration can be determined using standard methods (e.g., Bradford assay)
Analysis: Extracted proteins can be analyzed by techniques such as SDS-PAGE and Western blotting
When working with recombinant proteins expressed in bacterial systems, standard protein extraction protocols for E. coli are applicable, potentially involving cell lysis by sonication or chemical methods, followed by centrifugation to separate soluble and insoluble fractions .
Development of antibodies against Gracilaria ATP synthase components can follow methodologies similar to those employed for other Gracilaria proteins. Based on the research with Gracilaria changii proteins, the following approach is recommended:
Peptide design and synthesis:
Antibody production:
Validation of antibody specificity:
Research has shown that this approach successfully generated polyclonal antibodies specific to certain Gracilaria proteins (GcFBPA and GcGALE), though not all antibodies (like those against GcSMF) showed the expected protein band sizes when tested on native samples . This highlights the importance of thorough validation of antibody specificity before use in experimental applications.
Recombinant atpF can serve as a valuable tool for investigating stress responses in Gracilaria tenuistipitata, particularly in relation to bioenergetic adaptations. Methodological approaches include:
Expression analysis under stress conditions:
Generate specific antibodies against atpF
Use Western blotting to quantify protein expression levels under various stress conditions
Correlate expression levels with physiological parameters
Site-directed mutagenesis studies:
Create mutations in recombinant atpF to mimic stress-induced modifications
Analyze how these modifications affect protein function
Develop in vitro assays to measure ATP synthesis efficiency
Protein-protein interaction studies:
Use recombinant atpF as bait in pull-down assays
Identify interaction partners that may be involved in stress response
Investigate how these interactions change under stress conditions
Previous research has shown that promoter regions of Gracilaria genes contain abundant cis-acting regulatory elements related to abiotic stress and hormone responsiveness , suggesting that ATP synthase components may be regulated in response to environmental stressors. Understanding these regulation mechanisms could provide insights into how Gracilaria species adapt their energy metabolism to changing environmental conditions.
The study of ATP synthase in Gracilaria tenuistipitata may provide insights into the organism's antioxidant mechanisms, particularly in relation to cellular energy metabolism and oxidative stress. Research applications include:
Investigation of energy production during oxidative stress:
ATP synthase function may be modulated during oxidative stress
Changes in ATP production could influence cellular defense mechanisms
Recombinant atpF can be used to study how oxidative stress affects ATP synthase activity
Correlation between ATP synthase activity and antioxidant defense:
Studies have shown that G. tenuistipitata extracts exhibit significant antioxidant properties, including DPPH radical scavenging activity and protection against H₂O₂-induced DNA damage
ATP levels may influence the cell's capacity to maintain antioxidant systems
Investigation of how ATP synthase efficiency correlates with antioxidant capacity
Development of biomarkers for stress tolerance:
ATP synthase components may serve as biomarkers for stress tolerance
Comparison of atpF expression or modification patterns between stress-resistant and susceptible strains
Potential for developing screening tools to identify strains with enhanced antioxidant properties
Research has demonstrated that aqueous extracts of G. tenuistipitata show potent DPPH scavenging activity (60% at just 3 mg/mL), suggesting strong antioxidant potential . Understanding how energy metabolism, mediated by ATP synthase, contributes to this antioxidant capacity could enhance the economic and scientific value of this red algal species.
Comparative analysis of ATP synthase across algal species reveals significant structural and functional variations that may reflect evolutionary adaptations to different ecological niches:
Structural comparisons:
Research on Euglena gracilis has shown its ATP synthase to be structurally distinct, being larger than that found in yeast with 13 unique subunits out of 29 total subunits
While specific structural data for G. tenuistipitata ATP synthase is limited in the provided sources, it likely possesses unique features adapted to its marine environment
Comparative structural studies using cryo-electron microscopy would be valuable for identifying these distinctive features
Functional adaptations:
Different algal species may exhibit variations in ATP synthesis efficiency
These differences could reflect adaptations to specific light conditions, temperature ranges, or salinity levels
Comparative enzymatic studies could reveal how these adaptations influence energy metabolism
Evolutionary implications:
Structural differences in ATP synthase components may provide insights into evolutionary relationships among algal species
Shared unique features may indicate common ancestry or convergent evolution under similar environmental pressures
Methodologically, comparative studies would benefit from combining structural biology approaches (X-ray crystallography, cryo-EM) with functional assays and phylogenetic analyses to create a comprehensive understanding of ATP synthase evolution across algal lineages.
Interpretation of experimental data on fibroblast proliferation in response to Gracilaria extracts requires careful statistical analysis and consideration of biological significance. Based on available research:
Statistical analysis approach:
Data interpretation considerations:
The following data table from research on Gracilaria verrucosa illustrates how fibroblast numbers change over time with different extract concentrations:
| Day and group | Mean of fibroblast number | Std deviation | p-value |
|---|---|---|---|
| 7th day | 0.754 | ||
| Control | 9.80 | 2.17 | |
| 2.5% G. verrucosa | 9.60 | 4.45 | |
| 5% G. verrucosa | 10.60 | 5.03 | |
| 10% G. verrucosa | 7.80 | 4.44 | |
| 14th day | 0.039* | ||
| Control | 11.96 | 0.89 | |
| 2.5% G. verrucosa | 12.96 | 2.25 | |
| 5% G. verrucosa | 13.92 | 1.50 | |
| 10% G. verrucosa | 14.96 | 1.11 | |
| 28th day | 0.027* | ||
| Control | 1.36 | 0.41 | |
| 2.5% G. verrucosa | 6.56 | 4.12 | |
| 5% G. verrucosa | 7.32 | 2.13 | |
| 10% G. verrucosa | 7.36 | 4.48 |
*Statistically significant at p < 0.05
This data shows that while there were no significant differences in fibroblast numbers at day 7, significant differences emerged at days 14 and 28, with higher concentrations of G. verrucosa extract generally associated with greater fibroblast proliferation, particularly in later stages .
Several promising research directions for ATP synthase components from Gracilaria species include:
Structural biology and comparative genomics:
Biotechnological applications:
Development of recombinant ATP synthase components as biomarkers for stress tolerance
Exploration of potential applications in bioenergy, leveraging the efficient energy conversion systems of algae
Investigation of unique properties that might be exploited for novel biotechnological tools
Ecological and evolutionary studies:
Analysis of how ATP synthase adaptations contribute to Gracilaria species' success in various marine environments
Investigation of how invasive Gracilaria species (like G. vermiculophylla) impact native ecosystems and foundation species
Comparative studies of ATP synthase evolution across algal lineages
Integration with antioxidant research:
Given the demonstrated antioxidant properties of Gracilaria extracts and their potential applications in food, cosmetics, and pharmaceutical industries , research connecting these properties to the organism's energy metabolism could significantly enhance the economic and scientific value of this red algal resource.
Advancement of research on recombinant Gracilaria proteins would benefit from several methodological improvements:
Expression system optimization:
Development of algal-specific expression vectors optimized for red algal codon usage
Exploration of alternative expression hosts that may better accommodate algal protein folding
Standardization of protocols for soluble expression of challenging proteins like those that typically form inclusion bodies
Structural characterization enhancements:
Functional assay development:
Creation of standardized in vitro assays for ATP synthase activity measurement
Development of cell-based assays to evaluate functional impact of recombinant proteins
Integration of biophysical techniques for measuring protein-protein interactions specific to ATP synthase components
Antibody generation improvements:
These methodological advances would address current challenges in research, such as the inconsistent antibody specificity observed in studies with Gracilaria proteins, where some antibodies (against GcSMF) failed to show the expected protein band sizes when tested on native samples .