Recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b', chloroplastic (atpG)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase and its Subunits

ATP synthase, also known as F$$_0$$F_1\-ATPase, is a vital enzyme complex found in the thylakoid membranes of chloroplasts, the inner mitochondrial membrane of mitochondria, and the plasma membrane of bacteria . Its primary function is to synthesize adenosine triphosphate (ATP), which serves as the major energy currency of the cell, by utilizing the proton-motive force generated across the membrane during photosynthesis (in chloroplasts) or oxidative phosphorylation (in mitochondria) .

The ATP synthase complex consists of two main components:

  • F_0\: A membrane-embedded component that forms a channel for proton translocation across the membrane.

  • F_1\: A peripheral membrane component that catalyzes the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate (P_i\ .

The F_1\ component is composed of five subunits: α, β, γ, δ, and ε. The F_0\ component consists of subunits a, b, and c. Different organisms can have variations in the number and types of subunits, but the general function remains the same .

Gracilaria tenuistipitata var. liui

Gracilaria tenuistipitata var. liui is a red alga known for its ability to produce agar, pigments, carbohydrates, and minerals . Aqueous extracts of Gracilaria tenuistipitata (AEGT) have demonstrated anti-inflammatory and hepatoprotective effects, suggesting its potential as a supplement for managing inflammatory and liver diseases . It has been cultivated in Taiwan since 1961 and can be cultivated in large scale .

ATP Synthase in Gracilaria tenuistipitata var. liui

The complete plastid genome of Gracilaria tenuistipitata var. liui has been sequenced, revealing a circular genome of 183,883 bp in length with a GC content of 29.1% . The plastid genome encodes a single copy of ribosomal RNA genes and contains genes involved in the biosynthesis of amino acids, fatty acids, and components of the photosynthetic apparatus .

ATP Synthase Subunit b', Chloroplastic (atpG)

The atpG gene encodes the ATP synthase subunit b', which is a component of the F_0\ complex in chloroplasts . The Gene Bio Systems company provides recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b', chloroplastic (atpF), for research purposes . Although the product name mentions atpF, it is likely a typo, and it refers to atpG.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Grc000143; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
atpG
Target Protein Sequence
MIVFPFLLFQMLSTEVEGGLFDFNATLPLMALQFIILTTILNFIFYKPVTNVLDERDEYI RNSLTTASASLVKADELTKTYEQQLAESRKKAQDIIKVAQEQAQQIVSVKIKDAQAYGEK LVSEAFHQLSIQKEDALKTLEMQVDTLSDLIKSKLLND
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP in the presence of a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b'-subunit, a component of the F(0) channel and part of the peripheral stalk, connects F(1) and F(0). In plants and photosynthetic bacteria, the b'-subunit is a diverged and duplicated form of the b-subunit.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How does ATP synthase subunit b' differ from ATP synthase subunit b in Gracilaria tenuistipitata?

While both subunits are components of chloroplastic ATP synthase in Gracilaria tenuistipitata var. liui, they differ in several aspects:

FeatureATP synthase subunit b' (atpG)ATP synthase subunit b (atpF)
GeneatpG (Grc000143)atpF (Grc000144)
Protein length158 amino acids182 amino acids
Alternative namesATP synthase F(0) sector subunit b', ATPase subunit IIATP synthase F(0) sector subunit b, ATPase subunit I
UniProt IDQ6B8R1Q6B8R0
FunctionComponent of F₀ sector, membrane-embedded portionComponent of F₀ sector, membrane-embedded portion

What is the genomic context of the atpG gene in the chloroplast of Gracilaria tenuistipitata?

The atpG gene is located in the chloroplast genome of Gracilaria tenuistipitata var. liui, which has been fully sequenced. The chloroplast genome of this red alga is highly conserved compared to other red algal species. The gene content of red algal plastid genomes, including that of G. tenuistipitata, is well-preserved across the Rhodophyta phylum, with a large core repertoire of plastid genes shared among different species .

What are the optimal conditions for expressing and purifying recombinant atpG from Gracilaria tenuistipitata var. liui?

For successful expression and purification of recombinant atpG from Gracilaria tenuistipitata var. liui, researchers should consider the following protocol:

Expression System Selection:

  • Bacterial expression systems (e.g., E. coli) are commonly used for recombinant chloroplast proteins

  • For membrane proteins like ATP synthase subunits, specialized strains designed for membrane protein expression are recommended

Purification Strategy:

  • Extract using a Tris-based buffer containing detergents suitable for membrane proteins

  • Perform affinity chromatography using an appropriate tag (determined during the production process)

  • Store the purified protein in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

Quality Control:

  • Verify protein identity using mass spectrometry or immunoblotting

  • Assess purity using SDS-PAGE

  • Confirm functionality through ATP hydrolysis or synthesis assays, similar to those used for other ATP synthase components

How can researchers effectively design a two-group experiment to study the function of atpG in ATP synthesis?

A two-group experimental design is appropriate for investigating the functional role of atpG in ATP synthesis. This approach establishes a cause-effect relationship between atpG and ATP synthase activity.

Experimental Design Framework:

  • Formulate a hypothesis: For example, "Recombinant atpG is essential for the proper functioning of reconstituted ATP synthase complexes from Gracilaria tenuistipitata"

  • Define experimental variables:

    • Independent variable: Presence/absence of functional atpG

    • Dependent variable: ATP synthesis activity

  • Establish experimental groups:

    • Experimental group: Reconstituted ATP synthase complex with wild-type atpG

    • Control group: Reconstituted ATP synthase complex with mutated or absent atpG

  • Random assignment: Ensure samples are randomly distributed between groups

  • Standardize conditions: Maintain identical buffer conditions, temperature, pH, and substrate concentrations

Methodological Implementation:

  • Preparation: Express and purify wild-type atpG and (if applicable) mutant variants

  • Reconstitution: Incorporate the proteins into liposomes or nanodiscs with other ATP synthase components

  • Measurement: Assess ATP synthesis rates using luciferase-based assays or radioactive methods

  • Analysis: Compare ATP synthesis rates between groups using appropriate statistical tests

This approach is similar to studies performed on other ATP synthase components, such as the β subunit loop experiment that demonstrated the coupling of catalysis and rotation .

What methodologies can be used to study the interaction between atpG and other subunits of ATP synthase?

Several complementary techniques can be employed to study the interactions between atpG and other ATP synthase subunits:

1. Co-immunoprecipitation (Co-IP):

  • Use specific antibodies against atpG to pull down the protein and its binding partners

  • Analyze the precipitated complexes by mass spectrometry to identify interacting proteins

  • Western blotting can confirm specific interactions with known ATP synthase subunits

2. Crosslinking Mass Spectrometry:

  • Apply chemical crosslinkers to stabilize protein-protein interactions

  • Digest the crosslinked complexes and analyze by mass spectrometry

  • Map the identified crosslinked peptides to determine specific interaction sites

3. Fluorescence Resonance Energy Transfer (FRET):

  • Label atpG and potential interaction partners with compatible fluorophores

  • Measure energy transfer between fluorophores to assess protein proximity

  • Similar approaches have been used to study the DELSEED-loop of the β subunit in ATP synthase

4. Cryo-electron Microscopy (Cryo-EM):

  • Visualize the entire ATP synthase complex at near-atomic resolution

  • Map the position of atpG within the complex

  • Identify specific residues involved in inter-subunit interactions

5. Mutagenesis Studies:

  • Generate targeted mutations in atpG

  • Assess the effect on ATP synthase assembly and function

  • Quantify changes in interaction strength with other subunits

These methodologies can be combined to provide a comprehensive understanding of how atpG contributes to ATP synthase structure and function.

How does the atpG protein from Gracilaria tenuistipitata var. liui compare to homologous proteins in other red algae in terms of structure and function?

The ATP synthase subunit b' (atpG) from Gracilaria tenuistipitata var. liui is part of a highly conserved set of plastid genes found across red algae (Rhodophyta). Comparative analysis reveals several important insights:

Sequence Conservation:
A comparative analysis of atpG proteins from various red algal species shows significant sequence homology, reflecting their conserved function in ATP synthesis. The chloroplast genomes of red algae, including that of G. tenuistipitata var. liui and related species like G. taiwanensis, share substantial synteny and gene content .

Structural Features:
Despite high conservation, subtle structural differences exist between atpG proteins from different red algal species. These differences may reflect adaptations to specific environmental conditions or evolutionary divergence:

SpeciesatpG LengthNotable Structural FeaturesGenomic Context
G. tenuistipitata var. liui158 aaMembrane-spanning domains typical of F₀ componentsPart of conserved gene arrangement in chloroplast genome
G. taiwanensisSimilarHigh similarity to G. tenuistipitataPart of 191,270 bp circular chloroplast genome with 233 protein-coding genes
G. firmaSimilarPart of conserved ATP synthase complexLocated within 187,001 bp chloroplast genome with extensive synteny to other Gracilariales

Functional Implications:
Despite the differences, the fundamental function of atpG in proton transport and ATP synthesis appears conserved across red algae. This conservation suggests that the protein plays a critical role in the energy metabolism of these organisms, with variations potentially reflecting fine-tuning rather than major functional changes .

What are the challenges in using recombinant atpG for ATP synthase reconstitution experiments, and how can they be addressed?

Reconstituting functional ATP synthase complexes using recombinant atpG presents several challenges that researchers must overcome:

Challenges and Solutions:

  • Membrane Protein Stability:

    • Challenge: Hydrophobic ATP synthase subunits like atpG are difficult to maintain in stable, folded conformations outside their native membrane environment.

    • Solution: Use specialized detergents or lipid nanodiscs to mimic the membrane environment. Store in optimized buffer with 50% glycerol and avoid freeze-thaw cycles .

  • Proper Complex Assembly:

    • Challenge: Ensuring correct incorporation of atpG into the multi-subunit ATP synthase complex.

    • Solution: Step-wise reconstitution protocols with carefully controlled stoichiometry of subunits. Validation of assembly by analytical ultracentrifugation or native gel electrophoresis.

  • Functional Assessment:

    • Challenge: Verifying that the reconstituted complex performs ATP synthesis rather than just ATP hydrolysis.

    • Solution: Design two-group experiments comparing wild-type and mutant forms, measuring both ATP synthesis and hydrolysis activities under controlled conditions .

  • Protein-Lipid Interactions:

    • Challenge: The lipid environment significantly impacts ATP synthase function, yet recombinant systems often lack native lipids.

    • Solution: Incorporate specific lipids found in red algal chloroplast membranes into reconstitution mixtures. Recent studies on ATP synthases from other organisms have highlighted the importance of protein-lipid interactions for proper dimerization and function .

  • Species-Specific Adaptations:

    • Challenge: Functional differences between red algal ATP synthase and better-studied bacterial or mitochondrial counterparts.

    • Solution: Utilize comparative approaches that account for structural and functional differences, employing methodologies that have been successful with other ATP synthase variants .

How can researchers develop and validate a specific antibody against Gracilaria tenuistipitata var. liui atpG for immunological studies?

Developing and validating a specific antibody against G. tenuistipitata var. liui atpG requires a systematic approach:

Development Strategy:

  • Antigen Design:

    • Analyze the atpG sequence to identify unique, immunogenic regions

    • Consider both peptide-based approaches (synthetic peptides from atpG sequence) and recombinant protein approaches

    • Design the antigen to minimize cross-reactivity with related ATP synthase subunits

  • Immunization Protocol:

    • Select appropriate host animals (rabbits are commonly used for polyclonal antibodies)

    • Employ a standard immunization schedule with appropriate adjuvants

    • Collect and process antisera according to established protocols

  • Antibody Purification:

    • Perform affinity purification using the immunizing antigen

    • Consider cross-adsorption against related proteins to increase specificity

Validation Approach:

  • Specificity Testing:

    • Western blot analysis against purified recombinant atpG

    • Testing against whole cell extracts from G. tenuistipitata var. liui

    • Cross-reactivity assessment with related proteins from other species

  • Sensitivity Assessment:

    • Determine detection limits using dilution series of target protein

    • Optimize antibody concentration for different applications

  • Functional Validation:

    • Immunoprecipitation of native ATP synthase complexes

    • Immunofluorescence localization in algal cells

    • Inhibition studies to assess antibody effects on ATP synthase activity

An example validation approach can be modeled after protocols used for other ATP synthase antibodies, such as the anti-AtpB antibody developed for plant mitochondrial ATP synthase beta subunit , while adapting the methodology for the specific characteristics of the algal atpG protein.

What are the evolutionary implications of studying atpG and the ATP synthase complex in red algae compared to other photosynthetic organisms?

Studying atpG and the ATP synthase complex in red algae provides valuable insights into evolutionary biology and the diversification of energy production systems across photosynthetic organisms:

Evolutionary Context:

Red algae (Rhodophyta) represent one of the oldest lineages of photosynthetic eukaryotes, with a unique evolutionary history distinct from green plants. Their chloroplasts are believed to have originated from primary endosymbiosis, in which a eukaryotic cell engulfed a cyanobacterium . The ATP synthase complex, including atpG, provides a window into this evolutionary history.

Comparative Genomic Insights:

The chloroplast genomes of red algae are highly conserved in gene content, though they show variation in genome size and gene arrangement. For instance, the chloroplast genome of G. tenuistipitata var. liui shares significant synteny with other Gracilariales, despite differences in genome size . The comparison of atpG sequences across these species can reveal:

  • Conservation Patterns:

    • Highly conserved regions likely represent functionally critical domains

    • Variable regions may reflect adaptation to specific ecological niches

  • Selection Pressures:

    • Analysis of nonsynonymous to synonymous substitution ratios can identify regions under positive or purifying selection

    • This can highlight functionally important residues specific to red algal ATP synthases

Functional Adaptations:

ATP synthase complexes from different photosynthetic lineages show adaptations to their specific environments. For example:

LineageATP Synthase AdaptationsPotential Functional Significance
Red AlgaeSpecific subunit composition and structureAdaptation to marine environments and unique photosynthetic pigments
Green PlantsDifferences in regulatory mechanismsAdaptation to terrestrial environments
CyanobacteriaSimpler subunit compositionReflects ancestral state of the complex

Biotechnological Applications:

Understanding these evolutionary adaptations offers potential applications:

  • Engineering ATP synthases with improved functionality under specific conditions

  • Developing algal strains with enhanced energy production capabilities

  • Creating chimeric ATP synthases that combine beneficial features from different lineages

These evolutionary insights contribute not only to our understanding of photosynthetic diversity but also to potential biotechnological applications in energy production and algal biotechnology .

How can researchers effectively utilize chloroplast-targeting peptides with recombinant atpG for in vivo studies in other organisms?

For in vivo studies involving recombinant atpG in heterologous systems, researchers must ensure proper chloroplast targeting. This requires careful selection and optimization of chloroplast-targeting peptides (cTPs):

Selection of Effective cTPs:

Recent research has identified highly efficient cTPs for chloroplast targeting . When working with recombinant atpG, researchers should consider:

  • cTP Efficiency Factors:

    • Length: The optimal cTP length influences targeting efficiency

    • Cleavage sites: Proper processing is essential for protein function

    • Amino acid composition: Specific motifs enhance chloroplast import

  • Comparative Performance:

    • Some newly identified cTPs show approximately 10 times higher chloroplast-targeting efficiency than widely used cTPs like Arabidopsis AtRbcS

    • Consider cTPs from cluster C (as defined in comparative studies) which demonstrate strong GFP signals specifically in chloroplasts

Experimental Implementation:

  • Vector Design:

    • Create fusion constructs with selected cTP at the N-terminus of atpG

    • Include appropriate reporter tags (e.g., fluorescent proteins) for localization studies

    • Ensure proper cleavage site recognition for processing after import

  • Validation Approach:

    • Confocal microscopy to confirm chloroplast localization

    • Western blot with fractionation to verify presence in chloroplast fraction

    • Functional assays to confirm integration into host ATP synthase complexes

  • Optimization Strategies:

    • Test multiple cTPs to identify optimal performance with atpG

    • Consider time-course expression analysis to determine peak import efficiency

    • Evaluate potential interference with atpG function after import

By carefully selecting and validating appropriate cTPs, researchers can effectively target recombinant atpG to chloroplasts for in vivo functional studies in heterologous systems .

What are the most effective methods for analyzing the role of atpG in ATP synthase oligomerization and membrane organization?

Investigating the role of atpG in ATP synthase oligomerization and membrane organization requires specialized techniques that address both structural and functional aspects:

Structural Analysis Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Provides high-resolution structural data of ATP synthase dimers and oligomers

    • Can reveal the position and interactions of atpG within these complexes

    • Recent cryo-EM studies have identified substoichiometric subunits and lipids at dimer interfaces of ATP synthases

  • Atomic Force Microscopy (AFM):

    • Visualizes membrane-embedded ATP synthase complexes in near-native conditions

    • Maps the topography of ATP synthase oligomers and their organization in membrane patches

    • Can monitor dynamic changes in organization upon manipulation of atpG

  • Native Gel Electrophoresis:

    • Blue Native PAGE or Clear Native PAGE to separate intact ATP synthase complexes

    • Allows comparison of oligomeric states in wild-type vs. atpG-modified samples

    • Can be combined with second-dimension SDS-PAGE to analyze subunit composition

Functional Analysis Approaches:

  • Membrane Curvature Assessment:

    • ATP synthase dimers and oligomers generate membrane curvature essential for efficient energy conversion

    • Electron microscopy of reconstituted proteoliposomes can reveal the impact of atpG modifications on membrane morphology

    • Fluorescence-based assays can quantify changes in membrane curvature

  • Protein-Lipid Interaction Studies:

    • Mass spectrometry-based lipidomics to identify specific lipids associated with ATP synthase complexes

    • Thin-layer chromatography of lipids co-purifying with ATP synthase

    • Reconstitution experiments with defined lipid compositions to assess the role of specific lipids in oligomerization

  • Functional Coupling Analysis:

    • Proton pumping assays to measure the efficiency of proton translocation

    • ATP synthesis measurements under controlled proton motive force conditions

    • Comparison between monomeric and oligomeric forms to assess functional significance

  • Site-Directed Mutagenesis:

    • Targeted modifications of atpG residues potentially involved in oligomerization

    • Assessment of the impact on both structural organization and functional parameters

    • Complementation studies in systems with modified or deleted native atpG

These approaches, particularly when used in combination, can provide comprehensive insights into how atpG contributes to ATP synthase oligomerization and the functional significance of this organization for chloroplast energy conversion .

What are the future directions for research involving Gracilaria tenuistipitata var. liui atpG and ATP synthase?

Future research involving G. tenuistipitata var. liui atpG and ATP synthase should focus on several promising directions:

  • Structural Biology and Protein Engineering:

    • Determination of high-resolution structures of the complete red algal ATP synthase complex

    • Engineering of chimeric ATP synthases incorporating beneficial features from different species

    • Investigation of structure-function relationships through targeted mutations

  • Evolutionary and Comparative Studies:

    • Expanded phylogenetic analysis of ATP synthase components across diverse algal lineages

    • Investigation of adaptive evolution in response to different environmental conditions

    • Comparative functional studies between red algal, green algal, and higher plant ATP synthases

  • Systems Biology Approaches:

    • Integration of ATP synthase function into whole-cell metabolic models of red algae

    • Investigation of regulatory networks controlling ATP synthase expression and assembly

    • Multi-omics studies to understand energy metabolism coordination in different conditions

  • Biotechnological Applications:

    • Development of optimized expression systems for recombinant red algal proteins

    • Exploration of potential biotechnological applications in bioenergy production

    • Engineering of algal strains with enhanced photosynthetic efficiency through ATP synthase optimization

  • Climate Change Adaptation Studies:

    • Investigation of ATP synthase adaptation to changing ocean conditions (temperature, pH)

    • Assessment of energetic efficiency under projected future environmental scenarios

    • Identification of genetic variants with enhanced resilience to environmental stressors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.