Recombinant Gracilaria tenuistipitata var. liui Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Grc000050; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
petD
Target Protein Sequence
MSIIKKPDLTDPKLRAKLAKGMGHHYYGEPAWPNDILYMFPVVILGILACDVGLSILEPS VIGEPANPFATPLEILPEWYFFPTFNLLRVIPNKLVGVLSMASVPAGLITVPFIESVNKF QNPFRRPIATSVFLVGTIVAVWLGIGATMPLSKAITLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Gracilaria tenuistipitata var. liui and what is its taxonomic classification?

Gracilaria tenuistipitata var. liui is a red macroalga (Rhodophyta) first described by Zhang & Xia in 1988. It belongs to the genus Gracilaria, which comprises over 150 species worldwide, with 24 species reported in China. The holotype was collected from Haikou, Hainan Island, Guangdong Province, China, and cultured in a pond. This marine species is taxonomically classified within the Gigartinales order and has been documented in multiple locations including Guangdong Province, Guangxi Province, Taiwan, and Thailand .

The species has significant economic value, particularly in agar production and more recently as a potential biostimulant in agricultural applications. The type specimens are preserved in multiple institutions with the holotype specimen (tetrasporangial) cataloged as QD; 86-652 .

What is the cytochrome b6-f complex and what role does it play in photosynthesis?

The cytochrome b6-f complex (Cyt b6f) is a multi-subunit protein complex embedded in thylakoid membranes that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis in plants and cyanobacteria. This complex functions as a plastoquinol-plastocyanin oxidoreductase, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI) .

The complex consists of at least nine subunits in flowering plants, forming a functional dimer. Four large subunits (PetA, PetB, PetD, and PetC) organize the electron transfer chain, while four small subunits (including PetG, PetL, and PetN) are unique to oxygenic photosynthesis with functions still being elucidated .

Beyond electron transport, the Cyt b6f complex facilitates:

  • Proton translocation across the thylakoid membrane

  • Photosynthetic redox control of energy distribution between photosystems

  • Regulation of gene expression

  • State transitions between photosystems, as revealed by studies of ΔpetN mutants

What is the structure and genomic context of the petD gene in Gracilaria tenuistipitata var. liui?

The petD gene in Gracilaria tenuistipitata var. liui is located within its circular plastid genome, which has been completely sequenced and comprises 183,883 base pairs. The genome contains 238 predicted genes, including the petD gene that encodes subunit 4 of the cytochrome b6-f complex .

Comparative genomic analysis with the plastid genome of Porphyra purpurea reveals strong conservation of gene content and order, though there are major genomic rearrangements and the presence of coding regions specific to Gracilaria. The petD gene is part of the most complete repertoire of plastid genes known in photosynthetic eukaryotes, reflecting the surprisingly ancient gene content maintained in the Gracilaria plastid genome .

The gene's sequence and structure provide important insights into the evolution of rhodoplasts (red algal plastids) and their relationship to other plastids. Phylogenetic analysis using concatenated protein datasets that include the petD protein product supports red algal plastid monophyly and a specific evolutionary relationship between the Florideophycidae and the Bangiales .

How can knockout studies be designed to understand the function of cytochrome b6-f complex subunits?

Knockout studies to investigate cytochrome b6-f complex subunits require careful experimental design following these methodological approaches:

Generation of homoplastomic knockout lines:

  • Create targeted gene deletions using plastid transformation techniques

  • Ensure complete replacement of wild-type plastid copies with the mutated version

  • Confirm homoplastomy through multiple rounds of selection and PCR verification

Analytical techniques for phenotypic characterization:

  • Assess growth phenotype under photoautotrophic and photoheterotrophic conditions

  • Measure photosynthetic electron transport rates

  • Quantify oxygen evolution activity with and without electron transport mediators like TMPD

  • Test sensitivity to specific inhibitors such as 2,5-dibromo-3-methyl-6-isopropylbenzoquinone

Protein accumulation analysis:

  • Perform immunoblot analysis using antibodies against various Cyt b6f subunits

  • Compare protein accumulation between wild-type and knockout lines

  • Assess effects on other photosystem components (PSII and PSI)

State transition evaluation:

  • Analyze 77K fluorescence spectra

  • Monitor room temperature fluorescence kinetics

  • Test with electron transport mediators to bypass the affected component

As demonstrated in studies of ΔpetG, ΔpetL, and ΔpetN mutants, this approach revealed differential effects on complex stability, with deletions of petG or petN causing complete loss of photosynthetic electron transport, while ΔpetL plants retained approximately 50% of other Cyt b6f subunits and maintained photoautotrophic growth .

What specific effects does the loss of small subunits have on the stability and function of the cytochrome b6-f complex?

The loss of small subunits in the cytochrome b6-f complex has distinct effects on its stability and function, as evidenced by research on knockout mutants:

Effects of PetN deletion:

  • Destabilization of the Cyt b6f complex

  • Reduction of large subunits to 20-25% of wild-type levels

  • Decreased oxygen evolution activity to ~30% of wild-type levels

  • Partial insensitivity to Cyt b6f inhibitors

  • Highly reduced plastoquinone pool under normal light conditions

  • Higher PSII/PSI ratio than wild-type

  • Abolished state transitions

Effects of PetG deletion:

  • Bleached phenotype

  • Loss of photosynthetic electron transport

  • Loss of photoautotrophy

  • Faint detection of cytochrome complex large subunits (Cyt f, Cyt b6, and subunit IV)

  • Slight effects on PSII and PSI components

  • Significant up-regulation of ATP synthase subunit α

Effects of PetL deletion:

  • Accumulation of ~50% of other Cyt b6f subunits

  • Retention of green phenotype

  • Maintenance of photoautotrophic growth

  • Normal levels of ATP synthase subunit α

This comparison demonstrates that despite their peripheral location in the complex, small subunits like PetN and PetG are essential for proper assembly and stability of the Cyt b6f complex, while PetL plays a less critical role.

How can recombinant DNA technology be applied to study the petD gene in Gracilaria tenuistipitata var. liui?

Applying recombinant DNA technology to study the petD gene in Gracilaria tenuistipitata var. liui involves several methodological approaches:

Gene isolation and characterization:

  • Extract total DNA from Gracilaria tenuistipitata var. liui

  • Amplify the petD gene using PCR with specific primers designed based on the sequenced plastid genome

  • Clone the amplified fragment into an appropriate vector system

  • Verify the sequence through DNA sequencing

Expression system development:

  • Design expression constructs with suitable promoters for the target organism

  • Include purification tags (His-tag or GST-tag) for easier protein isolation

  • Transform the recombinant construct into an appropriate host system (E. coli, yeast, or algal expression systems)

  • Optimize expression conditions (temperature, induction time, media composition)

Functional analysis of recombinant protein:

  • Purify the expressed protein using affinity chromatography

  • Perform biochemical assays to assess electron transport capability

  • Conduct structural studies using X-ray crystallography or cryo-EM

  • Compare properties with native protein complexes

Site-directed mutagenesis approaches:

  • Introduce specific mutations in the petD gene to study structure-function relationships

  • Create chimeric proteins by swapping domains with homologous proteins from other species

  • Analyze the impact of mutations on protein stability, complex assembly, and electron transport

This approach builds upon established recombinant DNA technologies that have been successfully used for creating transgenic organisms like GloFish, which were developed by inserting foreign DNA into zebrafish genomes .

What environmental and cultivation parameters optimize the growth and gene expression of Gracilaria tenuistipitata var. liui?

Optimizing growth and gene expression in Gracilaria tenuistipitata var. liui requires careful control of several environmental parameters:

Temperature regulation:

  • Maintain temperature between 20-30°C for optimal growth

  • Growth rates exceed 2% daily within this temperature range

  • Lower growth rates occur at temperature extremes (15°C and 32°C)

  • Mean daily growth rate of 2.4% is achievable under optimal conditions, resulting in biomass doubling each month

Salinity management:

  • Optimal growth occurs at 21‰ salinity

  • Growth plateaus in the range of 7-27‰

  • At controlled nitrogen levels, yields at 24‰ salinity are 1.3 times higher than at 30-34‰ salinity

Cultivation methods:

  • Pond cultivation is effective for Gracilaria tenuistipitata var. liui

  • Net cage systems allow for controlled experiments and regular harvesting

  • Maintain appropriate algal density by harvesting at proper growth periods

  • Specific growth rates can be calculated using the formula: μ = ln(Nt/N0)/t
    where N0 is initial biomass, Nt is final biomass, and t is time

Growth monitoring:
Monthly measurements of the following parameters:

  • Biomass accumulation

  • Environmental variables (temperature, salinity, dissolved oxygen)

  • Nitrogen content

  • Photosynthetic rates

For gene expression studies, samples should be collected during periods of both maximum growth (spring and fall months) and stress conditions (summer and winter extremes) to capture differential expression patterns of photosynthetic genes, including petD .

What molecular techniques can assess expression and regulation of the petD gene under different environmental conditions?

To assess expression and regulation of the petD gene under varying environmental conditions, several molecular techniques can be employed:

RNA isolation and quantification:

  • Extract total RNA from Gracilaria samples collected under different conditions

  • Treat with DNase to remove genomic DNA contamination

  • Assess RNA quality using spectrophotometry and gel electrophoresis

  • Synthesize cDNA through reverse transcription

Gene expression analysis:

  • Quantitative PCR (qPCR):

    • Design primers specific to the petD gene

    • Use reference genes for normalization

    • Calculate relative expression using comparative Ct method (2^-ΔΔCt)

  • RNA-Seq:

    • Prepare libraries from different treatment conditions

    • Sequence using high-throughput platforms

    • Map reads to the Gracilaria tenuistipitata var. liui plastid genome

    • Analyze differential expression of petD and related genes

Protein analysis:

  • Western blotting:

    • Extract total protein from samples

    • Separate by SDS-PAGE

    • Transfer to membrane and probe with antibodies against PetD

    • Quantify band intensity for relative protein levels

  • Blue-native PAGE:

    • Extract thylakoid membranes under non-denaturing conditions

    • Separate intact protein complexes

    • Assess cytochrome b6-f complex assembly and stability

Transcription factor analysis:

  • Chromatin immunoprecipitation (ChIP):

    • Cross-link DNA-protein complexes

    • Immunoprecipitate with antibodies against potential regulatory factors

    • Identify binding regions through qPCR or sequencing

These techniques can reveal how environmental factors like temperature and salinity affect petD expression and cytochrome b6-f complex assembly, providing insights into the molecular mechanisms of photosynthetic adaptation in Gracilaria tenuistipitata var. liui.

How can phylogenetic approaches be used to understand the evolution of petD in red algae?

Understanding the evolution of the petD gene in red algae requires sophisticated phylogenetic approaches:

Data acquisition and preparation:

  • Obtain petD gene sequences from diverse red algal species and other photosynthetic organisms

  • Align sequences using algorithms suitable for conserved genes (MUSCLE, MAFFT)

  • Test multiple alignment parameters and trimming strategies

  • Consider protein-coding characteristics by examining codon positions separately

Phylogenetic signal assessment:

  • Employ treeness triangles to visualize phylogenetic signal strength

  • Compare different distance corrections:

    • Uncorrected p distances

    • Jukes-Cantor (JC) distances

    • LogDet distances

    • Maximum likelihood distances

Tree reconstruction methods:

  • Maximum Likelihood:

    • Select appropriate evolutionary models using AIC or BIC criteria

    • Implement site-heterogeneous models to account for compositional biases

    • Perform bootstrap analyses (≥1000 replicates) for node support

  • Bayesian Inference:

    • Run multiple MCMC chains to ensure convergence

    • Assess posterior probabilities for clade support

    • Implement mixture models for compositional heterogeneity

Multi-gene approaches:

Network approaches for conflicting signals:

  • Split decomposition

  • Neighbor-Net analysis

  • Consensus networks

These methods have revealed that Gracilaria maintains a surprisingly ancient gene content in its plastid genome and, together with other Rhodophyta, contains the most complete repertoire of plastid genes known in photosynthetic eukaryotes .

What experimental design considerations are critical when studying recombinant proteins and their functional effects?

When studying recombinant proteins derived from the cytochrome b6-f complex, careful experimental design is essential to ensure reliable and reproducible results:

Sample size calculation and power analysis:

  • Determine appropriate sample sizes based on expected effect sizes

  • Calculate statistical power to detect meaningful differences

  • Consider variability in biological systems when planning replicates

Randomization and blinding strategies:

  • Randomize experimental units to treatment groups

  • Implement blinding protocols to minimize observer bias

  • Document randomization procedures thoroughly

Control selection:

  • Positive controls:

    • Wild-type protein for functional comparisons

    • Known functional variants with established phenotypes

  • Negative controls:

    • Empty vector transformants

    • Inactive protein variants (site-directed mutants)

    • Non-specific proteins of similar size/structure

Experimental variables management:

  • Control environmental conditions (temperature, light, media composition)

  • Standardize protein expression levels across variants

  • Monitor and document batch effects

Measurement approaches:

  • Direct biochemical assays:

    • Electron transport activity

    • Protein-protein interaction studies

    • Structural integrity assessments

  • Physiological measurements:

    • Oxygen evolution

    • Fluorescence parameters

    • Growth rates under varying conditions

Data analysis plan:

  • Pre-specify primary and secondary outcomes

  • Select appropriate statistical tests based on data distribution

  • Plan for dealing with missing data and outliers

The Experimental Design Assistant (EDA) offers a structured approach to planning such experiments, providing guidance on randomization, blinding, sample size calculation, and creating transparent experimental plans that can be shared with colleagues .

How can mass spectrometry techniques be applied to study post-translational modifications of the PetD protein?

Mass spectrometry (MS) provides powerful tools for characterizing post-translational modifications (PTMs) of the PetD protein:

Sample preparation strategies:

  • Isolation of intact cytochrome b6-f complex:

    • Thylakoid membrane solubilization with mild detergents

    • Purification by sucrose gradient ultracentrifugation

    • Ion exchange and/or size exclusion chromatography

  • PetD enrichment:

    • Immunoprecipitation with PetD-specific antibodies

    • Recombinant expression with affinity tags

    • Gel band excision following SDS-PAGE separation

  • Digestion protocols:

    • In-solution digestion with trypsin, chymotrypsin, or alternative proteases

    • Filter-aided sample preparation (FASP)

    • In-gel digestion for gel-separated proteins

MS approaches for PTM identification:

  • Bottom-up proteomics:

    • Liquid chromatography coupled to tandem MS (LC-MS/MS)

    • Data-dependent acquisition (DDA) for discovery

    • Parallel reaction monitoring (PRM) for targeted analysis

    • Electron transfer dissociation (ETD) for labile modifications

  • Top-down proteomics:

    • Direct analysis of intact PetD protein

    • High-resolution MS for accurate mass determination

    • Multiple fragmentation techniques to localize modifications

PTM-specific enrichment:

  • Phosphorylation:

    • Titanium dioxide (TiO2) enrichment

    • Immobilized metal affinity chromatography (IMAC)

    • Phospho-specific antibodies

  • Glycosylation:

    • Lectin affinity chromatography

    • Hydrazide chemistry

    • Hydrophilic interaction liquid chromatography (HILIC)

  • Redox modifications:

    • Differential alkylation strategies

    • Biotin-switch technique for S-nitrosylation

    • Targeted enrichment for carbonylation

Quantitative approaches:

  • Label-free quantification:

    • Intensity-based absolute quantification (iBAQ)

    • MS1 peak area integration

    • Spectral counting

  • Isotope labeling:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • TMT (Tandem Mass Tag) labeling

    • Chemical derivatization approaches

Data analysis and validation:

  • Database searching with PTM options enabled

  • Site localization scoring algorithms

  • False discovery rate control at peptide and PTM levels

  • Orthogonal validation techniques (western blotting, site-directed mutagenesis)

These approaches allow comprehensive characterization of regulatory PTMs on PetD that may influence complex assembly, stability, or electron transport function.

How can contradicting data regarding the role of petD mutants be reconciled through integrative analysis?

Reconciling contradicting data about petD mutants requires a systematic integrative analysis approach:

Data standardization and quality assessment:

  • Evaluate methodological differences between studies:

    • Organism and growth conditions

    • Mutation types (knockout, point mutations, insertions)

    • Measurement techniques and parameters

  • Assess data quality metrics:

    • Statistical power and sample sizes

    • Technical and biological replication

    • Controls and validation approaches

Multi-level data integration:

  • Functional categorization:

    • Group contradicting results by biological process (assembly, electron transport, complex stability)

    • Identify consistencies within subgroups of phenotypes

  • Meta-analysis techniques:

    • Quantitative synthesis of comparable measurements

    • Effect size calculations across studies

    • Forest plots to visualize variability

Mechanistic modeling:

  • Develop working models that could explain seemingly contradictory results

  • Test models with additional targeted experiments

  • Use in silico approaches to simulate different conditions

Resolution strategies for specific contradictions:

Contradictory ObservationPotential Reconciliation ApproachExample Methodology
Different growth phenotypesTest for genetic background effectsIntroduce identical mutations in multiple backgrounds
Variable complex stabilityExamine assembly kinetics vs. steady-statePulse-chase experiments with time-course analysis
Inconsistent electron transport ratesTest environmental sensitivityMeasure under standardized conditions across studies
Divergent state transition resultsAnalyze regulatory network differencesComparative transcriptomics/proteomics

Experimental design for resolution:

  • Apply spectral analysis, Neighbor-Net, and consensus networks approaches

  • Design factorial experiments testing multiple variables simultaneously

  • Use the Experimental Design Assistant (EDA) to create robust experimental plans

Collaborative approaches:

  • Establish standardized protocols across research groups

  • Perform interlaboratory validation studies

  • Create shared repositories of raw data and materials

This integrative framework helps distinguish genuine biological complexity from methodological artifacts, leading to a more coherent understanding of petD function.

How can recombinant Gracilaria tenuistipitata var. liui proteins be used in biotechnological applications?

Recombinant proteins from Gracilaria tenuistipitata var. liui, including the cytochrome b6-f complex components, offer several biotechnological applications:

Bioenergy applications:

  • Enhanced photosynthetic efficiency:

    • Engineering optimized cytochrome b6-f complexes for increased electron transport

    • Creating synthetic electron transport chains with improved energy conversion

    • Developing hybrid systems combining algal proteins with artificial photosynthetic components

  • Biofuel production:

    • Utilizing engineered proteins in microbial or algal biofuel systems

    • Optimizing electron transport for hydrogen production

    • Creating cell-free enzymatic systems for energy conversion

Biosensing technologies:

  • Environmental monitoring:

    • Developing protein-based biosensors for detecting pollutants

    • Creating systems that measure photosynthetic inhibitors

    • Engineering stress-responsive reporter systems

  • Metabolic analysis:

    • Designing tools to measure electron transport chain activity

    • Creating systems for redox state monitoring

    • Developing high-throughput screening platforms

Agricultural applications:

  • Plant biostimulants:

    • Utilizing extracts containing bioactive compounds

    • Testing effects on crop stress tolerance

    • Developing formulations for foliar application

    Recent research demonstrated that Gracilaria tenuistipitata var. liui extracts at 5.0% and 10.0% concentrations improved soybean drought tolerance and yield through foliar application .

Pharmaceutical development:

  • Drug discovery platforms:

    • Using cytochrome complexes as targets for screening inhibitors

    • Developing protein-protein interaction assays

    • Creating systems to evaluate electron transport modulators

The implementation of these applications builds upon established recombinant DNA technologies that have already transformed the biotechnology industry through the ability to add new genes to cells, plants, and animals for producing medically valuable proteins .

How can the ecological impact of Gracilaria species be assessed when considering potential genetic modification?

Assessing the ecological impact of genetically modified Gracilaria species requires comprehensive evaluation methodologies:

Baseline ecological characterization:

  • Natural distribution mapping:

    • Document native ranges and invaded areas

    • Identify ecological niches and habitat preferences

    • Study population dynamics in natural settings

  • Ecosystem function assessment:

    • Evaluate role as habitat provider (e.g., for juvenile blue crabs)

    • Quantify primary production contribution

    • Assess interaction with native species

    Research has shown that non-native Gracilaria vermiculophylla can provide valuable nursery habitat where eelgrass has been extirpated, housing similar densities of juvenile blue crabs as seagrass beds .

Risk assessment framework:

  • Persistence evaluation:

    • Monitor growth rates under various environmental conditions

    • Assess reproductive potential and dispersal mechanisms

    • Evaluate competitive interactions with native species

  • Gene flow analysis:

    • Measure potential for crossing with wild populations

    • Assess horizontal gene transfer risks

    • Evaluate stability of transgenes

Containment strategies:

  • Biological containment:

    • Develop sterile cultivars

    • Create conditional survival mutants

    • Implement auxotrophic dependencies

  • Physical containment:

    • Design closed cultivation systems

    • Develop protocols for preventing accidental release

    • Implement monitoring programs for early detection

Monitoring methodologies:

  • Field surveys:

    • Transect sampling (e.g., 20-m transects with 0.0625-m² quadrats)

    • Measurement of percent cover and biomass

    • Regional distribution mapping

  • Molecular surveillance:

    • Environmental DNA (eDNA) detection

    • Genetic barcoding for identification

    • Molecular markers for tracking spread

  • Statistical analysis:

    • Generalized linear models incorporating environmental factors

    • Analysis of variance across regions and habitats

    • Multivariate approaches for community impacts

This comprehensive approach ensures responsible development and deployment of genetically modified Gracilaria, balancing potential benefits with ecological safeguards.

What bioactivities of Gracilaria extracts might influence experimental studies of recombinant proteins?

When working with recombinant proteins from Gracilaria tenuistipitata var. liui, researchers must account for various bioactive compounds in extracts that could influence experimental outcomes:

Documented bioactivities of Gracilaria extracts:

BioactivityEvidencePotential Experimental Impact
AntibacterialMultiple Gracilaria species extracts tested May affect microbial expression systems
AntiviralReported in literature review Could interfere with viral vector systems
AntifungalDocumented across 19 Gracilaria species May impact fungal-based expression platforms
AntioxidantRadical scavenging effects demonstrated Could protect or alter redox-sensitive proteins
ImmunomodulatoryImmunostimulant and phagocytosis stimulation activities Might affect in vivo testing systems
Anti-inflammatoryVariable activities depending on extract type Could influence inflammation-based assays
Enzyme inhibitionEffects on tyrosinase, penicillinase, aldose reductase Potential interference with enzymatic assays

Experimental control strategies:

  • Extract fractionation and purification:

    • Use chromatographic techniques to isolate specific components

    • Compare activity of purified recombinant proteins vs. crude extracts

    • Implement stepwise purification to track bioactivities

  • Control experiments:

    • Include extract-only controls without recombinant proteins

    • Use extracts from non-transformed organisms for comparison

    • Test for additive, synergistic, or antagonistic effects

  • Analytical approaches:

    • Characterize extract composition using metabolomics

    • Identify potential interfering compounds

    • Develop targeted assays for specific bioactive molecules

  • Alternative expression systems:

    • Consider heterologous expression in bacteria, yeast, or mammalian cells

    • Compare properties of proteins expressed in different systems

    • Optimize purification protocols to remove algal compounds

When designing experiments with recombinant Gracilaria proteins, researchers should implement these controls to distinguish specific protein effects from those of co-extracted bioactive compounds .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.