Recombinant Gracilaria tenuistipitata var. liui Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

Cytochrome b6 is a core subunit of the cytochrome b<sub>6</sub>f complex, which facilitates:

  • Linear Electron Transport: Mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) .

  • Cyclic Electron Flow: Supports ATP synthesis independently of PSII .

  • Regulation of Photosynthetic Efficiency: Balances energy distribution between PSI and PSII via state transitions .

Studies on homologous systems (e.g., cyanobacteria) demonstrate that Cytochrome b6 stability and interaction with accessory subunits (e.g., PetP) are critical for complex dimerization and electron transport rates . Loss of regulatory subunits like PetP reduces linear electron transport by ~50%, highlighting the interdependence of b<sub>6</sub>f components .

Expression Systems

  • Cell-Free Expression: Used for high-yield production without membrane integration challenges .

  • E. coli: Provides cost-effective synthesis but may require refolding for proper tertiary structure .

Purification Metrics

  • Purity: ≥85% as verified by SDS-PAGE .

  • Activity: Retains electron transfer functionality in reconstituted b<sub>6</sub>f complexes .

Research Applications

Recombinant Gracilaria Cytochrome b6 is utilized in:

  • Structural Studies: Mapping transmembrane helices and heme-binding sites via X-ray crystallography .

  • Interaction Assays: Pull-down experiments to identify binding partners (e.g., PetD subunit) .

  • Functional Analyses: Measuring electron transport kinetics in synthetic lipid membranes .

For example, Strep-tagged variants have been used in affinity chromatography to isolate b<sub>6</sub>f subcomplexes, confirming interactions with PetD .

Genomic and Evolutionary Context

The petB gene is encoded in the plastid genome of Gracilaria tenuistipitata var. liui (GenBank: NC_006137.1) . Comparative genomics reveals:

  • Conservation: Strong synteny with Porphyra purpurea, another red alga, but with unique coding regions specific to Gracilaria .

  • Ancestral Features: Retention of ancestral genes (e.g., leuC/D for leucine biosynthesis) absent in green algae .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Grc000051; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCIGGIVFTSFLIQVASGFAMTFYYRP TVAEAFSSVEYIMTDVNFGWLIRSIHRWSASMMVLMLILHMFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGGSIVELLRGGVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Gracilaria tenuistipitata var. liui and why is it important for cytochrome b6 research?

Gracilaria tenuistipitata var. liui is a red macroalga belonging to the Rhodophyta phylum, subclass Florideophycidae. It has garnered significant research interest due to several unique characteristics:

  • It possesses a completely sequenced circular plastid genome of 183,883 bp containing 238 predicted genes, including the petB gene

  • The species maintains an ancient gene content in its plastid genome and contains one of the most complete repertoires of plastid genes known in photosynthetic eukaryotes

  • It has adapted to varying salinity and nitrogen conditions, with optimal growth in salinities of 12-20%

  • The species has been identified as a causative macroalgal species in blooms occurring in the brackish lake of Shenzhen Bay, China from 2010 to 2014

Studying cytochrome b6 (petB) in this species provides valuable insights into photosynthetic mechanisms in red algae and their evolutionary relationship to other plastid-containing organisms.

How is the petB gene organized in the chloroplast genome of G. tenuistipitata var. liui?

The petB gene in G. tenuistipitata var. liui is located in the chloroplast genome. Based on comprehensive genomic analyses:

  • The petB gene encodes the cytochrome b6 protein, a key component of the cytochrome b6f complex in the thylakoid membrane

  • The gene is part of the photosynthetic electron transport system genes maintained in the chloroplast genome

  • Unlike some other photosynthetic genes that have been transferred to the nucleus in certain algal lineages, the petB gene remains chloroplast-encoded in G. tenuistipitata var. liui

  • The chloroplast genome of G. tenuistipitata var. liui shows strong conservation of gene content and order compared to other red algae like Porphyra purpurea, though there are some major genomic rearrangements

What are the most effective methods for isolating chloroplast DNA from G. tenuistipitata var. liui?

Two primary methods have been successfully employed to obtain sequencing templates from G. tenuistipitata var. liui and related species:

Method 1: Conventional CsCl Purification Approach

  • Requires generation of large quantities of cells

  • Involves recovery of highly purified cpDNA using CsCl gradients

  • Labor-intensive but yields high-purity chloroplast DNA

Method 2: Fosmid Cloning Method (Recommended)

  • Requires minimal biological material

  • Avoids isolation of pure cpDNA

  • Total genomic DNA is cloned into fosmid vectors

  • Chloroplast-derived fosmids are identified by end-sequencing or by PCR screening

  • More rapid, efficient, and cost-effective than conventional methods

A step-by-step protocol:

  • Harvest algal material and wash thoroughly with seawater, followed by distilled water

  • Dry samples and store with silica gel to absorb moisture

  • Extract DNA using a plant DNA extraction kit (e.g., DNeasy Plant Mini Kit) with slight modifications for algal tissue

  • For fosmid cloning, prepare genomic DNA and clone into fosmid vectors

  • Screen fosmid libraries through end-sequencing or PCR to identify chloroplast-derived clones

What PCR strategies are most successful for amplifying the petB gene from G. tenuistipitata var. liui?

Based on successful amplification strategies for photosynthetic genes in algae:

Primer Design Strategy:

  • Design specific or degenerate primers based on conserved regions of petB sequences

  • Successful degenerate primers for related genes like psbC and psbD have been designed with the following properties :

    • Target conserved regions across algal species

    • Include multiple primers for overlapping fragments

    • Incorporate degeneracy at variable positions

PCR Protocol:

  • Extract total genomic DNA using standard methods

  • Use a high-fidelity DNA polymerase (e.g., TaKaRa Ex Taq)

  • Prepare reaction mix with: 10× buffer, 0.2 mM dNTP mixture, 0.5 U polymerase, 0.3 mM of each primer, and 3 μL genomic DNA

  • Optimize cycling conditions:

    • Initial denaturation: 95°C for 5 min

    • 30-35 cycles of: 95°C for 30 sec, 50-55°C for 30 sec, 72°C for 1 min/kb

    • Final extension: 72°C for 10 min

  • Purify PCR products using a purification kit (e.g., QIAquick PCR Purification Kit)

  • Clone products into appropriate vectors (e.g., pGEM-T) for sequencing if direct sequencing is challenging

What expression systems are most suitable for producing recombinant cytochrome b6 from G. tenuistipitata var. liui?

When selecting an expression system for recombinant cytochrome b6, consider the following factors:

Bacterial Expression Systems (E. coli):

  • Advantages: Rapid growth, high yield, well-established protocols

  • Challenges: May form inclusion bodies, lacks post-translational modifications, heme incorporation issues

  • Recommended strains: BL21(DE3), C41(DE3), or C43(DE3) for membrane proteins

  • Expression vectors: pET series with T7 promoter systems

Eukaryotic Expression Systems:

  • Yeast (P. pastoris): Better for folding complex proteins with modifications

  • Algal systems: Consider using Chlamydomonas reinhardtii for homologous expression environment

Key Considerations for Successful Expression:

  • Codon optimization for the host organism

  • Addition of a purification tag (His-tag, preferably at N-terminus)

  • Co-expression with chaperones to assist folding

  • Supplementation with δ-aminolevulinic acid (ALA) as a heme precursor

  • Use of weak promoters to prevent aggregation of membrane proteins

A comparable purification protocol has been successfully used for cytochrome b6f complex from Chlamydomonas reinhardtii, which could be adapted:

  • Selective solubilization from thylakoid membranes using neutral detergents like Hecameg

  • Sucrose gradient sedimentation

  • Hydroxylapatite chromatography

How can the functionality of recombinant cytochrome b6 be verified?

To verify the functionality of recombinant cytochrome b6, researchers should employ multiple complementary approaches:

Spectroscopic Analysis:

  • Absorption spectroscopy: Functional cytochrome b6 shows characteristic alpha bands at 564 nm (b hemes)

  • Redox potential measurements: The b hemes in cytochrome b6 should have Em,8 values of approximately -84 and -158 mV

Functional Assays:

  • Electron transfer activity: Measure electron transfer from decylplastoquinol to oxidized plastocyanin

  • A functional cytochrome b6f complex should show turnover numbers of 250-300 s-1

Structural Verification:

  • Circular dichroism to confirm proper secondary structure

  • Size exclusion chromatography to verify oligomeric state

  • Blue native PAGE to assess complex formation

Reconstitution Experiments:

  • Reconstitution of recombinant cytochrome b6 with other purified components of the cytochrome b6f complex

  • Assessment of the reconstituted complex using the functional assays described above

How can recombinant cytochrome b6 be used to study the impact of environmental factors on photosynthetic efficiency?

Recombinant cytochrome b6 can serve as a powerful tool for studying how environmental factors affect photosynthetic efficiency, particularly relevant given G. tenuistipitata's adaptation to varying conditions:

Experimental Approach:

  • Express recombinant cytochrome b6 and reconstitute functional complexes

  • Subject the recombinant protein to varying experimental conditions:

    • Different salinity levels (12-20% optimal for G. tenuistipitata)

    • Varying nitrogen sources (NH4+ vs. NO3-)

    • Different light intensities (150-1,000 μmol photons m-2s-1)

    • Various sediment concentrations (0-2.28 mg/L)

Measurement Parameters:

  • Electron transfer rates under different conditions

  • Spectroscopic changes indicating alterations in protein structure or cofactor environment

  • Redox potential shifts in response to environmental variables

Correlation with Whole-Organism Studies:
Research on intact G. tenuistipitata has shown:

  • Growth rates are significantly higher when nitrogen source (NH4+, NO3-) concentrations reach 40 μM or above

  • Algal biomass is approximately 1.4 times higher when cultured with NH4+ compared to NO3-

  • NH4+ uptake follows a linear, rate-unsaturated response, while NO3- uptake follows the Michaelis-Menten model (Vmax = 37.2 μM g-1 DM h-1, Ks = 61.5 μM)

This correlation allows researchers to connect molecular-level changes in cytochrome b6 function with whole-organism responses to environmental stressors.

What approaches can be used to study structure-function relationships in recombinant cytochrome b6?

To elucidate structure-function relationships in recombinant cytochrome b6, researchers can employ the following methodologies:

Site-Directed Mutagenesis:

  • Target conserved residues involved in:

    • Heme binding and coordination

    • Quinone binding sites

    • Protein-protein interaction interfaces

  • Create single and multiple mutations to assess their impact on:

    • Spectroscopic properties

    • Redox potentials

    • Electron transfer rates

    • Complex assembly

Chimeric Protein Construction:

  • Create fusion proteins with homologous regions from cytochrome b6 of other species

  • Compare the properties of these chimeras to understand the role of specific domains

Truncation Analysis:

  • Generate truncated versions of cytochrome b6 to identify minimal functional domains

  • Assess the impact of removing specific regions on protein stability and function

Correlation with Natural Variants:

  • Analyze the five haplotypes (T1-T5) identified in G. tenuistipitata populations from different geographic regions

  • Determine if natural variations in the petB gene correlate with functional differences in the protein

X-ray Crystallography or Cryo-EM:

  • Attempt to solve the structure of recombinant cytochrome b6 alone or as part of the b6f complex

  • Compare structural features with those of homologous proteins from other organisms

How does cytochrome b6 from G. tenuistipitata var. liui compare to homologs in other photosynthetic organisms?

Comparative analysis of cytochrome b6 across species provides valuable evolutionary insights:

Sequence Conservation:

  • The cytochrome b6 protein is generally well-conserved across photosynthetic organisms

  • In G. tenuistipitata var. liui, the petB gene is part of an ancient gene content maintained in its plastid genome

Structural Comparisons:

  • The cytochrome b6f complex typically contains:

    • Four high molecular weight subunits (cytochrome f, Rieske iron-sulfur protein, cytochrome b6, and subunit IV)

    • Three approximately 4-kDa miniproteins (PetG, PetL, and PetX)

  • The b6f complex contains two b hemes (alpha bands at 564 nm) per cytochrome f

Functional Conservation and Differences:

Evolutionary Context:

  • Red algal plastids like those in G. tenuistipitata var. liui represent one of the most ancient photosynthetic lineages

  • Phylogenetic analysis supports red algal plastid monophyly and a specific evolutionary relationship between the Florideophycidae and the Bangiales

  • The chloroplast genome of G. tenuistipitata var. liui contains 238 predicted genes, representing the most complete repertoire of plastid genes known in photosynthetic eukaryotes

How can recombinant cytochrome b6 be used to investigate the molecular basis of regulatory mechanisms in the photosynthetic electron transport chain?

Studies on related systems have revealed important regulatory roles for components of the cytochrome b6f complex, which can be investigated using recombinant proteins:

Investigation of the PetM Subunit:

  • Studies in cyanobacteria have shown that the PetM subunit of the cytochrome b6f complex plays a regulatory role

  • In PetM-deficient mutants:

    • The content of phycobilisomes and photosystem I is reduced

    • Under aerobic conditions, cytochrome f re-reduction kinetics are slower

    • Increased plastoquinol oxidase activity causes the plastoquinone pool to be more oxidized under aerobic dark conditions

Experimental Approaches with Recombinant Cytochrome b6:

  • Reconstitution Experiments:

    • Reconstitute the cytochrome b6f complex with or without specific subunits

    • Measure electron transfer rates under different conditions

    • Assess the impact of specific subunits on complex stability and function

  • Protein-Protein Interaction Studies:

    • Use recombinant cytochrome b6 to identify interaction partners in the thylakoid membrane

    • Employ techniques such as pull-down assays, cross-linking, and yeast two-hybrid screening

    • Map interaction domains through mutation and truncation analysis

  • State Transition Studies:

    • Investigate the role of the cytochrome b6f complex in state transitions

    • Examine how phosphorylation of light-harvesting complexes is regulated by the redox state of the plastoquinone pool

    • Determine how cytochrome b6 contributes to this regulatory process

What are the most common challenges in expressing and purifying recombinant cytochrome b6, and how can they be overcome?

Researchers working with recombinant cytochrome b6 often encounter several challenges:

Challenge 1: Poor Expression Yields
Solutions:

  • Optimize codon usage for the expression host

  • Lower induction temperature (16-20°C)

  • Use specialized strains designed for membrane protein expression

  • Consider autoinduction media instead of IPTG induction

  • Test different promoter strengths to find optimal expression level

Challenge 2: Improper Heme Incorporation
Solutions:

  • Supplement growth media with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis

  • Co-express heme biosynthesis enzymes

  • Add hemin to the culture medium

  • Optimize expression conditions to allow sufficient time for heme incorporation

Challenge 3: Protein Aggregation/Inclusion Body Formation
Solutions:

  • Use milder detergents like Hecameg (6-O-(N-heptylcarbamoyl)-methyl-alpha-D-glycopyranoside) for solubilization

  • Express at lower temperatures (16-20°C)

  • Reduce expression rate by lowering inducer concentration

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Consider fusion tags that enhance solubility (MBP, SUMO)

Challenge 4: Low Purification Yield
Solutions:

  • Optimize detergent type and concentration for solubilization

  • Implement a three-step purification protocol similar to that used for the cytochrome b6f complex:

    • Selective solubilization from membranes

    • Sucrose gradient sedimentation

    • Hydroxylapatite chromatography

  • Consider using styrene maleic acid lipid particles (SMALPs) to extract membrane proteins with their native lipid environment

Challenge 5: Loss of Activity During Purification
Solutions:

  • Maintain reducing conditions throughout purification

  • Include stabilizing agents (glycerol, specific lipids)

  • Minimize exposure to light and oxidizing conditions

  • Perform functional assays at each purification step to track activity

How can researchers optimize experimental conditions for studying the interaction between recombinant cytochrome b6 and other components of the photosynthetic electron transport chain?

Optimizing interaction studies requires careful consideration of multiple factors:

Buffer Optimization:

  • Test different buffer compositions (pH 6.5-8.0, ionic strength 50-200 mM)

  • Include appropriate detergents at concentrations above critical micelle concentration

  • Add stabilizing agents (glycerol 10-20%, specific lipids)

  • Maintain reducing conditions with agents like DTT or β-mercaptoethanol

Reconstitution Strategies:

  • Detergent-Based Reconstitution:

    • Mix purified components in appropriate detergent

    • Remove detergent gradually using Bio-Beads or dialysis

    • Monitor complex formation using BN-PAGE or size exclusion chromatography

  • Liposome Reconstitution:

    • Prepare liposomes with lipid composition mimicking thylakoid membranes

    • Incorporate proteins using detergent-mediated reconstitution

    • Verify orientation using protease protection assays

Interaction Detection Methods:

  • Surface Plasmon Resonance (SPR):

    • Immobilize one component on a sensor chip

    • Flow the other component over the surface

    • Measure binding kinetics and affinity

  • Microscale Thermophoresis (MST):

    • Label one component fluorescently

    • Measure changes in thermophoretic mobility upon binding

    • Determine binding constants under near-native conditions

  • Förster Resonance Energy Transfer (FRET):

    • Label interaction partners with donor and acceptor fluorophores

    • Measure energy transfer as indication of proximity

    • Calculate distances between components

Electron Transfer Measurements:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.