Recombinant Gracilaria tenuistipitata var. liui Cytochrome c biogenesis protein ccs1 (ccs1)

Shipped with Ice Packs
In Stock

Description

Overview of Gracilaria tenuistipitata var. liui

Gracilaria tenuistipitata var. liui is a red algae (Rhodophyta) found in South-East Asia and China and is cultivated in southern China . This marine alga is economically significant as a source of phycocolloids and food .

Cytochrome c Biogenesis Protein Ccs1

Cytochrome c biogenesis protein Ccs1, also known as Ccs1, is a protein involved in cytochrome c biogenesis . The full-length recombinant Gracilaria tenuistipitata var. liui Cytochrome c biogenesis protein Ccs1(Ccs1) is a protein of 435 amino acids .

Amino Acid Sequence

The amino acid sequence of the recombinant full-length Gracilaria tenuistipitata var. liui Cytochrome c biogenesis protein Ccs1(Ccs1) is :

MNIKNILWFTLKKLSNLSLSISLLLLIASISIIGTIIEQNQSIVYYQMNYPINNQPFGRI
MNWKIILNLGLDHIYLNPCFVLVLVLFFCSLLACTFSNQLPSLRNARKWKFLQYKNHINC
NNHFVELDKISICNIIYSLYSNNYYIFHKENNIYAYKGLSGRIAPIVVHFSIILTFIGSL
ISLLGGFTAQEIIPTGEIFHIKNIIQSGFNSEIPNNITGKIKDFDIKYGPDNSVEQFVSK
IIIYNNQGKNINQKQVSVNSPLILKGITFYQTDWKIDTLRFKIGNSKIIQQPIIKYKINN
QILWSCRLPLNKEKYIFLVIANLNDKISIYDISNNLLTSIKLDETIVVNNTTLKIVEIMT
KTGIQVKTDPGIIVTYTGFFILMLSIVISYISYSQIWVTSIIQNIKIAGSTNRATLTFEE
EIINIQEIYTQYTWS

Nutritional Value of Gracilaria tenuistipitata var. liui

Gracilaria tenuistipitata var. liui has significant nutritional value, making it a potential food supplement .

Nutritional composition of Gracilaria tenuistipitata var. liui :

NutrientPercentage/Amount (Dry Weight)
Crude Protein25.55 ± 0.18%
Crude Fiber5.65 ± 0.13%
Crude Lipid0.16 ± 0.03%
Carbohydrates45.93 ± 1.53%
Ash10.61 ± 0.69%
Moisture12.10 ± 0.25%
Phosphorus596.90 ± 10.4 mg/100g
Calcium132.75 ± 3.4 mg/100g
Magnesium3.90 ± 1.2 mg/100g
Iron80.13 ± 2.45 mg/100g
Copper3.99 ± 1.2 mg/100g
Total Energy294.56 Kcal/100g
β-Carotene11.54 ± 1.20 mg/100g
Vitamin C2.5 mg/100g

Biosynthesis

Information on the specific biosynthesis pathways of Cytochrome c biogenesis protein Ccs1 in Gracilaria tenuistipitata var. liui is limited.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccs1; Grc000027; Cytochrome c biogenesis protein Ccs1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
ccs1
Target Protein Sequence
MNIKNILWFTLKKLSNLSLSISLLLLIASISIIGTIIEQNQSIVYYQMNYPINNQPFGRI MNWKIILNLGLDHIYLNPCFVLVLVLFFCSLLACTFSNQLPSLRNARKWKFLQYKNHINC NNHFVELDKISICNIIYSLYSNNYYIFHKENNIYAYKGLSGRIAPIVVHFSIILTFIGSL ISLLGGFTAQEIIPTGEIFHIKNIIQSGFNSEIPNNITGKIKDFDIKYGPDNSVEQFVSK IIIYNNQGKNINQKQVSVNSPLILKGITFYQTDWKIDTLRFKIGNSKIIQQPIIKYKINN QILWSCRLPLNKEKYIFLVIANLNDKISIYDISNNLLTSIKLDETIVVNNTTLKIVEIMT KTGIQVKTDPGIIVTYTGFFILMLSIVISYISYSQIWVTSIIQNIKIAGSTNRATLTFEE EIINIQEIYTQYTWS
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Protein Families
Ccs1/CcsB family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Gracilaria tenuistipitata var. liui Cytochrome c biogenesis protein ccs1 and what is its biological role?

Cytochrome c biogenesis protein ccs1 (ccs1) from Gracilaria tenuistipitata var. liui is a membrane protein involved in the assembly and maturation of c-type cytochromes in this red algal species. The protein plays a critical role in the electron transport chain by facilitating the covalent attachment of heme to apocytochromes, which is essential for their proper folding and function. This process is fundamental to energy metabolism in red algae, allowing for efficient photosynthetic and respiratory processes. The full-length protein consists of 435 amino acids and contains regions associated with membrane integration and heme handling . The protein is encoded by the ccs1 gene (also annotated as Grc000027) and has several transmembrane domains that anchor it within the membrane structure . Understanding its function contributes significantly to our knowledge of divergent cytochrome biogenesis pathways across photosynthetic organisms.

What is the amino acid sequence of the recombinant ccs1 protein, and what structural domains have been identified?

The full amino acid sequence of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 (UniProt ID: Q6B926) is: "MNIKNILWFTLKKLSNLSLSISLLLLIASISIIGTIIEQNQSIVYYQMNYPINNQPFGRIMNWKIILNLGLDHIYLNPCFVLVLVLFFCSLLACTFSNQLPSLRNARKWKFLQYKNHINCNNHFVELDKISICNIIYSLYSNNYYIFHKENNIYAYKGLSGRIAPIVVHFSIILTFIGSLISLLGGFTAQEIIPTGEIFHIKNIIQSGFNSEIPNNITGKIKDFDIKYGPDNSVEQFVSKIIIYNNQGKNINQKQVSVNSPLILKGITFYQTDWKIDTLRFKIGNSKIIQQPIIKYKINNQILWSCRLPLNKEKYIFLVIANLNDKISIYDISNNLLTSIKLDETIVVNNTTLKIVEIMTKTGIQVKTDPGIIVTYTGFFILMLSIVISYISYSQIWVTSIIQNIKIAGSTNRATLTFEEE IINIQEIYTQYTWS" . The protein contains multiple hydrophobic regions that form transmembrane domains, particularly evident in the N-terminal region (residues 1-50) and several internal segments. Based on bioinformatic analyses, the protein contains a signal peptide at its N-terminus followed by membrane-spanning domains that anchor it within the thylakoid or cellular membrane. Functional domains include regions associated with heme binding and interaction with apocytochromes, though specific binding sites have not been fully characterized in this algal variant . When comparing with homologous proteins like Arabidopsis thaliana CCS1, conserved cysteine residues and motifs involved in redox chemistry are likely present.

What are the optimal expression and purification methods for obtaining high-yield, functional recombinant ccs1 protein?

The recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 is optimally expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . For maximum yield and functionality, researchers should consider the following protocol: Begin with codon-optimized cDNA inserted into an expression vector containing a strong inducible promoter (such as T7) and the His-tag sequence. Transform this construct into an E. coli strain optimized for membrane protein expression, such as C41(DE3) or Rosetta™ strains, which provide tolerance for potentially toxic membrane proteins. Cultivation should proceed at reduced temperatures (16-20°C) after induction with low IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation and promote proper protein folding. For purification, cells should be lysed using a combination of enzymatic treatment and physical disruption, followed by membrane fraction isolation through differential centrifugation . The membrane-bound protein can then be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations just above their critical micelle concentration. Purification is achieved through immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, with stepwise washing and elution using increasing imidazole concentrations (20-250 mM) . Final purification may require additional steps such as size exclusion chromatography to achieve >90% purity as verified by SDS-PAGE.

What storage and reconstitution protocols are recommended to maintain the stability and activity of the recombinant ccs1 protein?

For optimal stability and activity preservation of the recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1, precise storage and reconstitution protocols must be followed. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C until ready for use . Prior to reconstitution, the vial should be briefly centrifuged to ensure all material is at the bottom. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with gentle mixing to ensure complete solubilization without causing protein denaturation . For long-term storage after reconstitution, it is recommended to add glycerol to a final concentration of 50%, creating working aliquots that prevent repeated freeze-thaw cycles. These working aliquots can be stored at -20°C to -80°C for extended periods, while aliquots for immediate experiments can be kept at 4°C for up to one week . The reconstitution buffer can be optimized based on experimental requirements, but a Tris/PBS-based buffer at pH 8.0 containing 6% trehalose is recommended as it helps maintain protein stability . For membrane proteins like ccs1, addition of appropriate detergents at concentrations above their critical micelle concentration may be necessary to maintain solubility. Researchers should avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and accelerate degradation . Activity assays should be performed before and after storage to confirm retention of functional properties.

What analytical techniques are most effective for characterizing the structure and function of recombinant ccs1 protein?

Comprehensive characterization of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 requires a multi-technique approach that addresses both structural and functional aspects. For primary structure confirmation, mass spectrometry (MS) techniques such as MALDI-TOF or ESI-MS should be employed to verify the intact protein mass and sequence coverage through peptide mapping after enzymatic digestion. Secondary and tertiary structure analyses can be conducted using circular dichroism (CD) spectroscopy to assess the α-helical content, which is particularly relevant for membrane proteins with transmembrane domains. Thermal shift assays can provide insights into protein stability under various buffer conditions. For membrane topology studies, limited proteolysis combined with MS analysis can identify exposed regions, while chemical labeling of accessible cysteine residues can map membrane-embedded segments. Functional characterization should include heme binding assays using UV-visible spectroscopy to monitor the characteristic Soret and Q bands associated with heme coordination. Electron transfer capability can be assessed using electrochemical techniques such as cyclic voltammetry or protein film voltammetry. Interaction studies with partner proteins should employ techniques such as bio-layer interferometry (BLI), isothermal titration calorimetry (ITC), or surface plasmon resonance (SPR) to determine binding kinetics and affinities. Advanced structural analyses might include cryo-electron microscopy for membrane-embedded proteins or X-ray crystallography if crystals can be obtained, potentially requiring lipidic cubic phase crystallization approaches for this membrane protein. Each analytical technique should be optimized for the specific properties of ccs1, accounting for its membrane protein nature and functional requirements in cytochrome c biogenesis.

What functional assays can be designed to study the activity of recombinant ccs1 protein in vitro?

To effectively study the activity of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 in vitro, researchers can implement several specialized functional assays targeting different aspects of its biological role. A primary assay should focus on heme binding capacity, utilizing UV-visible spectrophotometry to monitor characteristic spectral shifts (particularly at ~410 nm and ~550-560 nm) when the protein interacts with heme. This can be quantified by titrating increasing concentrations of hemin against a fixed concentration of purified ccs1 protein. For assessing heme transfer activity, researchers can design a reconstitution system containing the recombinant ccs1, heme, and an apocytochrome c substrate, measuring the conversion to holocytochrome c through spectroscopic or electrophoretic methods (native PAGE coupled with heme staining). The thiol-disulfide oxidoreductase activity critical for cytochrome maturation can be evaluated using artificial substrates like DTNB (5,5'-dithiobis-2-nitrobenzoic acid) or monitoring the reduction state of cysteine residues in apocytochrome c using thiol-reactive probes such as IAEDANS. Researchers should also consider designing liposome reconstitution assays where ccs1 is incorporated into lipid bilayers that mimic the native membrane environment, allowing for assessment of its activity in a more physiologically relevant context. For all these assays, appropriate controls should include heat-inactivated protein, site-directed mutants affecting key functional residues, and assays performed under varying redox conditions to probe the redox-sensitivity of the protein's function. Kinetic parameters (Km, Vmax) should be determined where applicable to quantitatively characterize the protein's activity.

How can researchers design experiments to study the interaction between ccs1 and other components of the cytochrome c biogenesis pathway?

Investigating interactions between recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 and other components of the cytochrome c biogenesis pathway requires a systematic experimental approach. Researchers should first identify potential interaction partners through comparative genomics, examining the System II cytochrome c biogenesis pathway components in red algae and related organisms. Co-immunoprecipitation (Co-IP) assays can be designed using anti-His tag antibodies to pull down the recombinant His-tagged ccs1 along with any interacting proteins from algal cell extracts, followed by mass spectrometry analysis to identify the binding partners. For confirming direct interactions, in vitro binding assays such as pull-down experiments with purified recombinant proteins (both ccs1 and suspected partners) can be performed. Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) provides quantitative binding kinetics and affinity measurements between ccs1 and purified interaction partners. To visualize these interactions in cellular contexts, researchers can employ proximity ligation assays (PLA) or fluorescence resonance energy transfer (FRET) using fluorescently labeled proteins in reconstituted membrane systems or suitable cell models. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map the specific binding interfaces between ccs1 and its partners by identifying regions with altered solvent accessibility upon complex formation. For functional validation of these interactions, researchers should design complementation assays in which mutant strains deficient in cytochrome c biogenesis are transformed with constructs expressing wild-type or mutated versions of ccs1 and interacting partners, assessing the restoration of cytochrome c assembly and associated functions. Cross-linking mass spectrometry (XL-MS) using chemical cross-linkers of varying lengths can provide spatial constraints for modeling the three-dimensional arrangement of protein complexes involving ccs1.

What approaches can be used to investigate the membrane topology and integration of recombinant ccs1 protein?

Investigating the membrane topology and integration of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 requires a multi-faceted experimental approach. Researchers should begin with computational prediction tools such as TMHMM, Phobius, or TOPCONS to generate initial topology models based on the protein's 435-amino acid sequence . These predictions can identify potential transmembrane segments, cytoplasmic loops, and extramembrane domains. For experimental validation, selective membrane permeabilization combined with protease protection assays can be employed, where the accessibility of specific domains to proteases is assessed after permeabilization of either side of the membrane. Site-directed labeling approaches offer another powerful strategy, wherein cysteine residues are strategically introduced throughout the protein sequence (particularly in predicted loop regions), followed by accessibility testing using membrane-impermeable thiol-reactive reagents such as PEG-maleimide or MTSET. Positive labeling indicates exposure to the aqueous environment, while protection suggests membrane embedding. Fluorescence spectroscopy using environment-sensitive fluorophores attached to specific residues can provide information about the local microenvironment (hydrophobic vs. hydrophilic). For more detailed structural information, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions with differential solvent accessibility. Researchers can also employ electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling to measure distances between labeled residues and determine their membrane depth. To study membrane integration mechanisms, in vitro translation systems supplemented with microsomes or liposomes can be used, monitoring the incorporation efficiency of wild-type protein versus mutants with altered putative membrane insertion signals.

What are common challenges in expressing and purifying recombinant ccs1 protein, and how can they be addressed?

Researchers working with recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 frequently encounter several technical challenges that require specific troubleshooting approaches. Low expression yield is a common issue, often resulting from the protein's membrane-associated nature causing toxicity to E. coli host cells. This can be addressed by optimizing expression conditions including reducing induction temperature to 16°C, using lower IPTG concentrations (0.1-0.2 mM), and selecting specialized E. coli strains like C41(DE3) or Lemo21(DE3) engineered for membrane protein expression . Protein misfolding and aggregation represents another significant challenge, manifesting as inclusion body formation. Researchers can combat this by adding mild solubilizing agents such as 5-10% glycerol to the culture medium, incorporating compatible solutes like trehalose or proline, or utilizing fusion partners such as MBP (maltose-binding protein) or SUMO that enhance solubility. During purification, insufficient solubilization of the membrane-embedded protein can limit recovery. This requires careful detergent selection and optimization, with screening of multiple detergents (DDM, LDAO, CHAPS) at various concentrations to identify conditions that efficiently extract ccs1 while maintaining its native conformation . Protein instability during purification often leads to degradation and loss of function. Implementing a comprehensive protease inhibitor cocktail, maintaining cold temperatures throughout purification, and minimizing purification duration are essential protective measures. Additionally, researchers should consider the recombinant protein's potential requirements for cofactors or metal ions that might be necessary for proper folding and stability.

How can researchers address protein stability issues when working with recombinant ccs1 protein?

Maintaining stability of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 throughout experimental procedures requires systematic optimization of multiple parameters. Buffer composition plays a critical role in protein stability, with recommended Tris/PBS-based buffers at pH 8.0 supplemented with stabilizing agents such as 6% trehalose serving as an effective starting point . Researchers should perform buffer screening experiments testing various pH ranges (7.0-8.5), salt concentrations (150-500 mM NaCl), and buffer systems (Tris, HEPES, phosphate) to identify optimal conditions for their specific experimental needs. Addition of glycerol (20-50%) significantly enhances long-term stability by preventing protein aggregation and providing cryoprotection during freeze-thaw cycles . For this membrane protein, detergent selection and concentration are particularly critical; detergents must effectively solubilize the protein while preserving its native structure. Researchers should conduct detergent screening with various types (maltoside-based, glucoside-based, zwitterionic) at concentrations just above their critical micelle concentration, monitoring protein stability via size-exclusion chromatography and activity assays. Temperature management is essential, with storage at -80°C recommended for long-term preservation and 4°C suitable for short-term (one week) working aliquots . To prevent oxidative damage to cysteine residues that may be functionally important, addition of reducing agents such as DTT or β-mercaptoethanol (1-5 mM) should be considered, though their compatibility with downstream applications must be evaluated. Protein stability should be regularly assessed through multiple complementary methods including thermal shift assays, which can identify stabilizing additives, and time-course activity measurements to determine functional half-life under various storage conditions.

What quality control methods should be implemented to ensure the integrity and functionality of recombinant ccs1 protein preparations?

Comprehensive quality control of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 preparations requires implementation of multiple analytical methods to assess purity, integrity, identity, and functionality. Purity assessment should begin with SDS-PAGE analysis, where the recombinant protein should appear as a predominant band with purity exceeding 90% as determined by densitometric analysis . This should be complemented by more sensitive techniques such as capillary electrophoresis or reversed-phase HPLC to detect minor contaminants. Protein identity confirmation is essential and can be accomplished through Western blotting using antibodies against the His-tag or the protein itself, combined with peptide mass fingerprinting via mass spectrometry to verify sequence coverage and post-translational modifications. Structural integrity assessment should include size-exclusion chromatography to evaluate aggregation states and circular dichroism spectroscopy to confirm secondary structure elements characteristic of properly folded protein. For this membrane protein, detergent solubilization efficiency should be monitored through ultracentrifugation tests to ensure complete solubilization without formation of protein aggregates. Functional verification is particularly critical and should include heme-binding assays using UV-visible spectroscopy to detect the characteristic spectral shifts upon heme coordination. Thermal stability assessment using differential scanning fluorimetry (DSF) provides valuable information about protein folding and stability under various buffer conditions. Endotoxin testing is mandatory for preparations intended for immunological studies, with limulus amebocyte lysate (LAL) assays commonly employed with acceptance levels below 1 EU/mg protein. Researchers should develop standardized acceptance criteria for each quality parameter and maintain detailed batch records documenting production and quality control outcomes to ensure experimental reproducibility.

What NIH guidelines and regulatory considerations apply to research with recombinant ccs1 protein?

Research involving recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 falls under the regulatory framework established by the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, which applies to all institutions receiving NIH funding for such research. According to the guidelines, the scope encompasses "molecules that a) are constructed by joining nucleic acid molecules and b) that can replicate in a living cell, i.e., recombinant nucleic acids," as well as molecules resulting from their replication . The expression of recombinant ccs1 in E. coli systems requires adherence to appropriate biosafety practices and containment principles outlined in the NIH Guidelines. Since this work involves nonpathogenic prokaryotic host-vector systems (E. coli) expressing a non-toxin gene from red algae, it typically falls under Section III-D or III-E depending on the specific experimental details. Institutional Biosafety Committee (IBC) approval is mandatory before initiating experiments, requiring submission of detailed protocols describing the recombinant DNA constructs, expression systems, and safety measures . For larger-scale protein production exceeding 10 liters of culture, additional considerations under Section III-D-6 apply, potentially requiring enhanced containment practices. Researchers must also comply with institutional policies regarding biological material transport, waste disposal, and personnel training. While the protein itself (as opposed to the recombinant nucleic acids) may not directly fall under these guidelines once purified, the production process is regulated, and researchers should maintain documentation of regulatory compliance throughout the research process.

What biosafety considerations should researchers address when working with recombinant ccs1 protein?

When working with recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1, researchers must implement appropriate biosafety measures commensurate with the risk assessment of both the expression system and the protein itself. Although the ccs1 protein from red algae does not possess inherent toxicity or pathogenicity, standard biosafety practices for handling recombinant proteins should be followed. The expression system typically employs nonpathogenic E. coli strains (Risk Group 1), requiring Biosafety Level 1 (BSL-1) containment practices and facilities as defined in the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules . Laboratory personnel should receive specific training on standard microbiological practices, including aseptic technique, proper waste disposal, and decontamination procedures. Personal protective equipment (PPE) including laboratory coats, gloves, and eye protection should be worn during all procedures, from bacterial culture to protein purification. Engineering controls such as biological safety cabinets should be utilized when generating aerosols might occur, particularly during sonication or high-pressure homogenization steps of bacterial lysis. All waste materials containing recombinant organisms should be decontaminated before disposal, typically through autoclaving or chemical disinfection with an approved agent effective against the host organism . For the purified recombinant protein, chemical hazards associated with buffers, detergents, and reagents used in purification and storage often present greater risks than the protein itself, requiring appropriate chemical hygiene measures. A comprehensive risk assessment should be conducted and documented for all procedures involving the recombinant protein, with standard operating procedures (SOPs) developed and maintained for routine activities. Notification and approval from the Institutional Biosafety Committee (IBC) is required before initiating work, ensuring institutional oversight of safety practices.

How can recombinant ccs1 protein be utilized in comparative studies of cytochrome c biogenesis pathways across different organisms?

Recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 offers a valuable tool for comparative studies of divergent cytochrome c biogenesis systems across evolutionary lineages. Researchers can design comprehensive comparative biochemical studies by expressing and purifying homologous ccs1 proteins from diverse organisms representing different photosynthetic lineages (cyanobacteria, green algae, red algae, and plants) to examine functional conservation and specialization. These proteins can be subjected to identical biochemical assays, including heme binding kinetics, redox potential measurements, and interaction studies with conserved pathway components to quantitatively assess functional divergence. Structure-function relationship studies can be performed through domain swapping experiments, where corresponding regions between the red algal ccs1 and homologs like Arabidopsis thaliana CCS1 are exchanged to identify domains responsible for specific functional properties or interaction specificities . Complementation assays in mutant organisms lacking functional cytochrome c biogenesis machinery provide powerful in vivo approaches to assess functional equivalence across species boundaries. For example, expression of the Gracilaria ccs1 in Arabidopsis ccs1 mutants would reveal whether the red algal protein can functionally replace its plant counterpart despite evolutionary divergence. Researchers can utilize the recombinant protein in reconstitution experiments with different thylakoid membrane compositions reflecting various photosynthetic organisms to examine how membrane environment influences ccs1 function. Sophisticated evolutionary rate analysis of sequence divergence correlated with functional divergence in biochemical assays can identify regions under different selective pressures, providing insights into adaptation of cytochrome biogenesis to different cellular environments.

What potential applications exist for recombinant ccs1 protein in understanding photosynthetic electron transport evolution?

Recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 provides a powerful tool for investigating the evolution of photosynthetic electron transport systems across diverse lineages. Researchers can employ this protein in comparative biochemical studies to elucidate how cytochrome c maturation pathways have adapted to different photosynthetic architectures across evolutionary time. The red algal lineage represents a distinct evolutionary trajectory from green algae and plants, having incorporated primary endosymbiotic chloroplasts with unique thylakoid membrane organization and photosystem composition. By comparing the functional properties of ccs1 from Gracilaria with homologs from other photosynthetic organisms, researchers can identify specific adaptations in cytochrome biogenesis machinery that correlate with evolutionary innovations in photosynthetic electron transport chains. In vitro reconstitution experiments can be designed where the recombinant ccs1 is incorporated into artificial membrane systems mimicking ancestral or divergent thylakoid compositions, providing insights into how membrane environment influences protein function. Such experiments might reveal how evolutionary changes in lipid composition have co-evolved with cytochrome biogenesis machinery. The recombinant protein can also serve as a molecular probe for identifying interacting partners across species, potentially uncovering lineage-specific adaptations in the cytochrome c maturation network. Advanced structural studies comparing the three-dimensional architecture of ccs1 proteins from diverse photosynthetic organisms could reveal structural adaptations that correlate with functional divergence in electron transport capabilities. Researchers interested in synthetic biology applications might utilize insights from these evolutionary studies to engineer optimized cytochrome biogenesis systems for artificial photosynthetic devices, potentially enhancing electron transport efficiency in bioenergy applications.

What methodological approaches can be used to study post-translational modifications of recombinant ccs1 protein?

Investigating post-translational modifications (PTMs) of recombinant Gracilaria tenuistipitata var. liui cytochrome c biogenesis protein ccs1 requires sophisticated methodological approaches that can detect and characterize diverse chemical modifications. While specific PTMs of the Gracilaria ccs1 have not been well-characterized, comparative analysis with the Arabidopsis thaliana homolog suggests potential phosphorylation sites may exist, as the plant protein undergoes multiple phosphorylation events at specific serine and threonine residues . Researchers should implement a multi-tiered mass spectrometry (MS) strategy beginning with bottom-up proteomics, where the purified recombinant protein is enzymatically digested (using multiple proteases like trypsin, chymotrypsin, and GluC to ensure comprehensive sequence coverage), followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis. For phosphorylation studies specifically, enrichment techniques such as titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) should be employed prior to MS analysis to concentrate phosphopeptides. Electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods during MS/MS analysis provide advantages for preserving labile modifications like phosphorylation while generating informative fragment ions. To examine PTM dynamics, in vitro modification assays can be designed using purified kinases, phosphatases, or other modifying enzymes incubated with the recombinant ccs1, followed by MS analysis to monitor modification status. Site-directed mutagenesis of putative modification sites (identified by comparison with homologs or computational prediction) can assess the functional significance of specific PTMs through activity assays. For redox-dependent modifications (like disulfide bond formation or cysteine oxidation states), differential alkylation strategies using isotope-coded affinity tags can map the redox state of cysteine residues under varying conditions. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal how PTMs affect protein conformation and dynamics by comparing exchange rates between modified and unmodified protein forms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.