Recombinant Gracilaria tenuistipitata var. liui Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
ycf4; Grc000159; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
ycf4
Target Protein Sequence
MYTMAQIKTDKILGSRRISNYFWATIILLGGLSFFLVGLSSYLKIELLPFTKSTDLLFLP QGIIMTFYGTAAILISLFLWLTIIWNIGSGYNEFNRDIGLVTIYRLGFPGKNRLIKLRYK IHDIYSIKVQIQEGLTPKREIYLKTKDKREIPLTQVGQPMSLAQIEERAAFLAKFLGVIL EGIR
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthesis?

Ycf4 functions as a crucial auxiliary element in the Photosystem I (PSI) assembly process. It is not directly involved in PSI subunit synthesis but plays an essential role in the assembly and/or stability of the PSI complex . Research with Chlamydomonas reinhardtii has demonstrated that transformants lacking the ycf4 gene are unable to grow photoautotrophically and exhibit significant deficiency in PSI activity . Molecular interaction studies show that Ycf4 forms strong hydrogen bonds with multiple PSI subunits, particularly psaB, psaC, and psaH, with the Ycf4+psaC complex showing exceptionally stable interaction with bond lengths of 2.62-2.93Å .

How does Ycf4 structure and function compare across different photosynthetic lineages?

Comparative analysis reveals significant evolutionary conservation of Ycf4 across photosynthetic organisms with varying degrees of sequence identity. The deduced amino acid sequence of Ycf4 from Chlamydomonas reinhardtii (197 residues) displays 41-52% sequence identity with homologues from algae, land plants, and cyanobacteria, while Ycf3 (172 residues) shows higher conservation with 64-78% sequence identity .

Functionally, the importance of Ycf4 varies between species. In C. reinhardtii, absence of Ycf4 causes complete destabilization of the PSI complex, whereas in cyanobacteria, the PSI complex remains partially functional in corresponding mutants . In tobacco, Ycf4 knockout plants can still grow photoautotrophically despite severely impaired photosynthetic performance , demonstrating intriguing species-specific dependencies on this assembly factor.

How is the ycf4 gene organized in red algal genomes compared to other photosynthetic organisms?

In the red alga Gracilaria tenuistipitata var. liui, the ycf4 gene is encoded in the plastid genome. This differs from green algae like Chlamydomonas reinhardtii, where ycf4 is co-transcribed as part of the rps9-ycf4-ycf3-rps18 polycistronic transcriptional unit . The gene organization in red algal plastid genomes shows high conservation within the Florideophyceae class, with ycf4 typically found in a conserved gene cluster .

What approaches are most effective for studying Ycf4 function in photosynthetic organisms?

Several experimental approaches have proven effective for investigating Ycf4 function:

  • Gene knockout studies: Using biolistic transformation to disrupt the ycf4 gene with a chloroplast selectable marker cassette (e.g., aadA gene)

  • Structural analysis: Examining chloroplast ultrastructure in Ycf4 mutants using transmission electron microscopy (TEM) to observe structural anomalies in shape, size, and grana stacking

  • Transcriptome analysis: Assessing changes in gene expression patterns of PSI, PSII, and other photosynthetic components in Ycf4-deficient mutants

  • Protein-protein interaction studies: Using in-silico docking and experimental techniques to identify Ycf4 interaction partners and binding domains

  • Tandem affinity purification (TAP): Isolating Ycf4-containing complexes using TAP-tag technology for characterization of associated proteins and complexes

What methods can be used to express and purify recombinant Ycf4 for in vitro studies?

For recombinant Ycf4 production:

  • Expression systems: Recombinant Ycf4 from Gracilaria tenuistipitata var. liui can be expressed in E. coli or yeast expression systems

  • Affinity purification: Using N-terminal His-tag fusion for efficient purification via affinity chromatography

  • Storage conditions: Store purified protein at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles; working aliquots can be maintained at 4°C for up to one week

  • Buffer formulation: Storage in Tris-based buffer with 50% glycerol or Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been shown to optimize stability

  • Reconstitution protocol: It is recommended to centrifuge vials briefly before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage

Which domains of the Ycf4 protein are critical for its function in PSI assembly?

Research using truncated variants of Ycf4 has identified that the C-terminus (91 amino acids from the C-terminal end) plays a more crucial role in photosynthesis than the N-terminus (93 amino acids from the N-terminal end) . In-silico protein-protein interaction studies revealed:

Protein PartnerHydrogen Bonds with N-terminusHydrogen Bonds with C-terminus
psaB (PS-I)5Not specified
psaH (PS-I)Not specified12
psbC (PS-II)Not specified13
rps2 (Ribosomal)147
rps16 (Ribosomal)1811
rrn16 (Ribosomal)186
atpB (ATP Synthase)828
rpoB925

This data clearly demonstrates that the C-terminus forms more hydrogen bonds with critical photosynthetic proteins, particularly with ATP synthase components .

How does the absence of Ycf4 affect photosynthesis and plant development in different species?

The physiological consequences of Ycf4 deficiency vary significantly between species:

  • Chlamydomonas reinhardtii: Transformants lacking Ycf4 are completely unable to grow photoautotrophically and show no PSI activity, indicating complete destabilization of the PSI complex

  • Tobacco (Nicotiana tabacum): Ycf4 knockout plants exhibit a light green phenotype that becomes pale yellow with age, but can still grow photoautotrophically despite severely impaired photosynthetic performance

  • Cyanobacteria: Mutants lacking Ycf4 show a higher PSII/PSI ratio due to increased PSII levels and slightly reduced PSI, but remain capable of photoautotrophic growth

Microscopic examination of chloroplasts in Ycf4-deficient tobacco revealed significant structural anomalies in chloroplast shape, size, and grana stacking compared to wild-type plants .

What proteins interact with Ycf4 during PSI assembly and what is the nature of these interactions?

Ycf4 engages in multiple protein-protein interactions critical for PSI assembly:

  • Interactions with PSI subunits: Ycf4 forms strong hydrogen bonds with psaB, psaC, and psaH (7 hydrogen bonds each), with the Ycf4+psaC complex showing exceptional stability (bond lengths of 2.62-2.93Å)

  • Interactions with PSII components: Among PSII subunits, psaE forms 5 hydrogen bonds with Ycf4

  • ATP synthase interactions: The beta chain (atpB) of ATP synthase forms 12 hydrogen bonds with Ycf4 (bond lengths of 2.56-3.15Å)

  • Ribosomal protein interactions: Ycf4 forms 10 hydrogen bonds with rrn16, suggesting a potential role in coordinating translation with assembly processes

  • Complex formation: Ycf4 has been isolated in a large complex (>1500 kD) containing PSI polypeptides, suggesting its function within a large assembly machinery rather than as an independent factor

How can recombinant Ycf4 be utilized in studying PSI assembly mechanisms?

Recombinant Ycf4 provides valuable tools for investigating PSI assembly:

  • In vitro reconstitution assays: Purified recombinant Ycf4 can be used to reconstruct PSI assembly processes in vitro, allowing step-by-step analysis of the assembly pathway

  • Pull-down assays: Using tagged recombinant Ycf4 to identify novel interaction partners involved in PSI assembly

  • Structure-function studies: Site-directed mutagenesis of recombinant Ycf4 can help identify specific amino acids crucial for interaction with PSI components

  • Cryo-EM analysis: Recombinant Ycf4 in complex with PSI assembly intermediates can be visualized using cryo-electron microscopy to elucidate structural details of the assembly process

  • Cross-species complementation: Testing whether recombinant Ycf4 from Gracilaria can complement Ycf4 deficiency in other photosynthetic organisms could reveal evolutionary adaptations in PSI assembly mechanisms

What experimental design would be most effective for investigating the impact of environmental stress on Ycf4 function?

A comprehensive experimental approach should include:

  • Stress treatment matrix:

    • Salinity gradient (5-50 psu)

    • Temperature range (10-35°C)

    • Light intensity variation (50-1000 μE·m⁻²·s⁻¹)

    • Nutrient availability (N and P limitation)

  • Analytical methods:

    • RT-qPCR for ycf4 transcription quantification

    • Western blotting for Ycf4 protein abundance

    • Blue-native PAGE for PSI complex assembly analysis

    • Chlorophyll fluorescence measurements (Fv/Fm, ETR) to assess photosynthetic efficiency

    • 77K fluorescence spectroscopy to specifically examine PSI functionality

  • Temporal sampling:

    • Short-term responses (hours to days)

    • Long-term acclimation (weeks)

    • Recovery dynamics after stress removal

  • Subcellular localization:

    • Immunogold electron microscopy to track changes in Ycf4 localization under stress

    • Fractionation studies to assess Ycf4 association with thylakoid membranes

This design would provide comprehensive insights into how environmental stressors affect Ycf4 expression, localization, and function in PSI assembly in Gracilaria tenuistipitata.

What are the most promising research directions for understanding Ycf4 function in red algae?

Future research on Ycf4 in Gracilaria tenuistipitata var. liui and other red algae should focus on:

  • Comparative genomics and proteomics: Analyzing Ycf4 sequence conservation and functional variations across diverse red algal species to understand evolutionary adaptations

  • CRISPR-Cas9 genome editing: Developing efficient transformation systems for red algae to create precise Ycf4 mutants and study functional consequences

  • Structural biology approaches: Determining the three-dimensional structure of red algal Ycf4 using X-ray crystallography or cryo-EM to understand structural basis of function

  • Systems biology integration: Incorporating Ycf4 function into models of photosynthetic efficiency and biomass production in red algae

  • Ecological relevance: Investigating how Ycf4 function contributes to the ecological success of red algae in diverse marine environments, particularly under climate change scenarios

  • Industrial applications: Exploring how manipulation of Ycf4 might enhance growth rates or agar production in commercially important red algal species like Gracilaria tenuistipitata, which currently shows agar yields of 5-23% under varied cultivation conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.