Recombinant Gracilaria tenuistipitata var. liui Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psaF; Grc000005; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-187
Protein Length
Full Length of Mature Protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
psaF
Target Protein Sequence
EVETAGLTKCQESPAFTKRLNNSVKKLETRLAKYDANTPPAIALQTQIIKTKIRFNKYAK SGILCGTDGLPHLITDGRWNHAGEFMIPGVLFLYITGWIGWVGRGYLRDISQTTKPTEKE IILDVPLALKYCLSGFTWPLAAIKELTSGELVADNKDIPISPR
Uniprot No.

Target Background

Function

This protein likely plays a role in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein contributes to the specific binding of plastocyanin to Photosystem I.

Protein Families
PsaF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

How does G. tenuistipitata var. liui psaF compare with psaF proteins from other photosynthetic organisms?

Comparative analysis shows that the psaF protein from G. tenuistipitata var. liui shares significant structural similarity with psaF proteins from other photosynthetic organisms, but with distinct characteristics related to its red algal lineage. Studies of psaF proteins across species indicate that:

  • The C-terminal hydrophobic region (approximately 17 amino acids) is highly conserved across diverse photosynthetic organisms including cyanobacteria, green algae, and higher plants .

  • The N-terminal region shows more variability between taxonomic groups, reflecting evolutionary adaptation to different photosynthetic mechanisms.

  • Compared to the spinach (C3 plant) psaF protein, G. tenuistipitata's psaF maintains the core functional domains while exhibiting sequence variations consistent with its evolutionary position as a red alga .

The conservation pattern of psaF across photosynthetic lineages suggests its fundamental importance in photosystem I function, despite the considerable evolutionary distance between red algae and other photosynthetic organisms .

What is the genomic context of psaF in the Gracilaria tenuistipitata var. liui plastid genome?

The psaF gene is encoded in the circular plastid genome of Gracilaria tenuistipitata var. liui, which is 183,883 bp in size and contains 238 predicted genes. The plastid genome of G. tenuistipitata var. liui represents the first completely sequenced plastid genome from the subclass Florideophycidae (Rhodophyta) .

The genomic organization surrounding the psaF gene shows strong conservation with other red algae such as Porphyra purpurea, though some major genomic rearrangements have been identified. The psaF gene (identified by the locus name Grc000005) is part of the ancient gene repertoire maintained in the Gracilaria plastid .

Comparative genomic analysis reveals that:

  • Red algal plastids, including G. tenuistipitata var. liui, contain the most complete repertoire of plastid genes known among photosynthetic eukaryotes.

  • The gene order and content show remarkable conservation between Gracilaria and other red algae, despite evolutionary divergence.

  • The plastid genome of G. tenuistipitata var. liui contains some coding regions that are specific to Gracilaria and not found in other red algae like Porphyra .

What expression systems are recommended for recombinant production of G. tenuistipitata var. liui psaF?

Based on current research protocols, E. coli is the preferred expression system for recombinant production of G. tenuistipitata var. liui psaF protein. The methodology typically involves:

  • Gene synthesis or PCR amplification of the mature psaF protein sequence (amino acids 25-187).

  • Cloning into an expression vector with an N-terminal His-tag for purification purposes.

  • Transformation into an appropriate E. coli strain optimized for recombinant protein expression.

  • Induction of protein expression under controlled conditions (temperature, media composition, and induction time) .

While E. coli is predominantly used, other expression systems including yeast, baculovirus, and mammalian cell systems can be considered for specific research objectives, particularly when post-translational modifications or protein folding concerns exist . The choice of expression system should be guided by the intended use of the recombinant protein and the specific experimental requirements.

What purification strategies yield high-purity recombinant psaF protein?

Obtaining high-purity recombinant psaF protein typically involves a multi-step purification strategy:

Primary Purification:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or similar resin for His-tagged proteins.

  • Washing with increasing concentrations of imidazole to reduce non-specific binding.

  • Elution with high imidazole concentration buffer (typically 250-500 mM).

Secondary Purification (if needed):

  • Size exclusion chromatography to separate aggregates and contaminants of different molecular weights.

  • Ion exchange chromatography for further purification based on charge differences.

Using this approach, purity greater than 90% as determined by SDS-PAGE can be achieved . The purified protein is typically obtained in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability .

What storage conditions maximize stability of purified recombinant psaF?

To maximize stability of the purified recombinant G. tenuistipitata var. liui psaF protein, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C in appropriate buffer .

  • Long-term storage: Store at -20°C or preferably -80°C in buffer containing cryoprotectants .

  • Recommended storage buffer: Tris-based buffer with 50% glycerol, pH optimized for this specific protein (typically pH 8.0) .

  • Aliquoting: Divide purified protein into small working aliquots before freezing to avoid repeated freeze-thaw cycles, which can lead to protein degradation .

  • Reconstitution protocol: For lyophilized protein, brief centrifugation before opening is recommended, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 50% is recommended for storage stability .

Repeated freezing and thawing should be strictly avoided as it significantly reduces protein activity and structural integrity .

How can recombinant psaF be used to study photosynthetic electron transport?

Recombinant psaF can serve as a valuable tool for investigating photosynthetic electron transport through several experimental approaches:

These approaches can provide insights into how the psaF subunit contributes to docking of electron carriers like plastocyanin or cytochrome c6, and how it influences the efficiency of electron transfer within photosystem I .

What methodologies can assess the role of G. tenuistipitata var. liui psaF in stress response?

Recent studies indicate that extracts from G. tenuistipitata var. liui may play a role in stress response pathways, particularly in relation to drought tolerance . To investigate the specific contribution of psaF in these processes, researchers can employ several methodologies:

  • Recombinant protein application studies: Apply purified recombinant psaF protein to plant systems under controlled stress conditions to assess direct effects on physiological parameters.

  • Comparative transcriptomics: Compare gene expression patterns in plants treated with either whole G. tenuistipitata extracts or purified psaF protein under stress conditions.

  • Proteomic analysis: Identify interaction partners of psaF under different stress conditions using techniques like affinity purification coupled with mass spectrometry.

  • Functional assays: Measure photosynthetic efficiency parameters in the presence of recombinant psaF under various stress conditions.

These approaches can help determine whether psaF plays a direct role in stress mitigation or acts through interaction with other cellular components. Studies have shown that seaweed extracts, including those from Gracilaria species, can mitigate abiotic stress in plants, but the specific contribution of psaF to these effects requires further investigation .

How can researchers investigate evolutionary aspects of psaF using the G. tenuistipitata var. liui protein?

The G. tenuistipitata var. liui psaF protein offers valuable opportunities for evolutionary studies of photosynthetic systems. Researchers can employ several approaches:

  • Comparative sequence analysis: Align psaF sequences from diverse photosynthetic organisms, including cyanobacteria, red algae, green algae, and land plants, to identify conserved and lineage-specific regions. The highly conserved 17-amino acid hydrophobic region in the C-terminal part is of particular interest for evolutionary studies .

  • Phylogenetic reconstruction: Construct phylogenetic trees using psaF sequences to understand evolutionary relationships between photosynthetic lineages and test specific hypotheses about the evolution of photosystems.

  • Structural modeling: Generate comparative structural models of psaF from different lineages to identify structure-function relationships preserved across evolutionary time.

  • Functional complementation: Express G. tenuistipitata var. liui psaF in systems where the native psaF has been deleted or mutated to assess functional conservation across evolutionary distance.

These approaches can provide insights into the evolutionary history of photosystem I and the specific adaptations that have occurred in different photosynthetic lineages. The plastid genome of G. tenuistipitata var. liui, which contains the psaF gene, represents an ancient gene repertoire that provides valuable information about the evolution of photosynthetic systems .

What controls should be included when working with recombinant psaF in experimental setups?

When designing experiments involving recombinant G. tenuistipitata var. liui psaF, the following controls should be included to ensure robust and interpretable results:

  • Negative controls:

    • Empty vector-expressed protein prepared using identical protocols

    • Heat-denatured recombinant psaF to control for non-specific effects

    • Buffer-only controls that contain all components except the recombinant protein

  • Positive controls:

    • Native photosystem I preparations (when available)

    • Well-characterized recombinant psaF from model organisms like Arabidopsis thaliana or cyanobacteria

    • Commercially available photosystem components with established activity

  • Validation controls:

    • Western blot analysis to confirm protein identity and purity

    • Mass spectrometry to verify protein sequence and potential modifications

    • Activity assays to confirm functional integrity before experimental use

  • Experimental design controls:

    • Concentration gradients to establish dose-dependent effects

    • Time-course experiments to determine temporal dynamics

    • Multiple biological and technical replicates to ensure reproducibility

What analytical methods best characterize the biophysical properties of recombinant psaF?

To thoroughly characterize the biophysical properties of recombinant G. tenuistipitata var. liui psaF, researchers should consider the following analytical methods:

Analytical MethodInformation ProvidedExperimental Considerations
Circular Dichroism (CD)Secondary structure composition; conformational changes under varying conditionsRequires 0.1-1.0 mg/mL pure protein; buffer components must be CD-compatible
Differential Scanning Calorimetry (DSC)Thermal stability; unfolding transitionsProvides thermodynamic parameters of protein stability
Dynamic Light Scattering (DLS)Hydrodynamic radius; aggregation stateUseful for assessing sample homogeneity before structural studies
Fluorescence SpectroscopyTertiary structure information; ligand bindingCan detect subtle conformational changes upon interaction with binding partners
Surface Plasmon Resonance (SPR)Binding kinetics with interaction partnersRequires immobilization strategy that preserves protein function
Small-Angle X-ray Scattering (SAXS)Low-resolution solution structureComplements high-resolution structural techniques
Nuclear Magnetic Resonance (NMR)Atomic-level structural information; dynamicsLimited to smaller proteins or domains; requires isotopic labeling
Cryo-Electron MicroscopyHigh-resolution structural informationParticularly useful for membrane protein complexes

For optimal results, researchers should combine multiple complementary techniques to build a comprehensive biophysical profile of the recombinant protein. The choice of methods should be guided by the specific research questions and the physical properties of psaF as a membrane-associated protein .

How can researchers investigate post-translational modifications of native versus recombinant psaF?

Investigating post-translational modifications (PTMs) of native versus recombinant G. tenuistipitata var. liui psaF requires a multi-faceted approach:

  • Mass Spectrometry-Based Approaches:

    • Tandem mass spectrometry (MS/MS) following enzymatic digestion

    • Top-down proteomics to analyze intact proteins

    • Targeted multiple reaction monitoring (MRM) for specific modifications

  • Comparative Analysis Workflow:

    • Isolate native psaF from G. tenuistipitata var. liui thylakoid membranes

    • Express recombinant psaF in multiple expression systems (E. coli, yeast, insect cells)

    • Compare PTM profiles using identical analytical methods

    • Quantify differences in modification types, sites, and abundances

  • Functional Implications Assessment:

    • Generate recombinant psaF variants with site-directed mutagenesis at potential PTM sites

    • Compare functional properties of modified and unmodified proteins

    • Assess the impact of PTMs on protein-protein interactions and electron transfer efficiency

This comprehensive approach can reveal whether E. coli-expressed recombinant psaF lacks critical modifications present in the native protein, which might affect its functional properties. Such insights are essential for interpreting results from experiments using recombinant proteins and may guide the choice of expression systems for future studies .

What are the challenges and solutions in studying protein-protein interactions involving psaF in photosystem I assembly?

Studying protein-protein interactions involving psaF in photosystem I assembly presents several challenges, each with specific methodological solutions:

Challenges:

  • Membrane protein environment: psaF functions within the hydrophobic environment of the thylakoid membrane, making standard interaction assays difficult.

  • Structural integrity: Ensuring that recombinant psaF maintains native conformation for meaningful interaction studies.

  • Transient interactions: Many protein-protein interactions during photosystem assembly are dynamic and transient.

  • Complex assembly process: Photosystem I assembly involves multiple subunits in a coordinated process.

Methodological Solutions:

  • Membrane mimetic systems:

    • Reconstitution into nanodiscs or liposomes to provide a native-like membrane environment

    • Detergent screening to identify conditions that maintain protein structure and interaction capacity

  • Advanced interaction detection methods:

    • Chemical cross-linking coupled with mass spectrometry (XL-MS) to capture transient interactions

    • Förster resonance energy transfer (FRET) to monitor interactions in real-time

    • Single-molecule techniques to observe individual interaction events

  • In vivo approaches:

    • Split fluorescent protein complementation assays

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Genetic complementation studies in model photosynthetic organisms

  • Reconstitution experiments:

    • Stepwise reconstitution of photosystem I components

    • Time-resolved structural methods to capture assembly intermediates

By combining these approaches, researchers can build a comprehensive understanding of how psaF interacts with other photosystem components during assembly and how these interactions contribute to the function of the mature complex .

What computational modeling approaches can predict the impact of specific amino acid substitutions in psaF?

Computational modeling offers powerful tools for predicting the impact of specific amino acid substitutions in G. tenuistipitata var. liui psaF. Researchers can implement a multi-level modeling strategy:

  • Sequence-Based Predictions:

    • Evolutionary conservation analysis using multiple sequence alignments to identify functionally critical residues

    • Statistical coupling analysis to detect co-evolving residue networks

    • Machine learning algorithms trained on known mutation effects in related proteins

  • Structural Modeling:

    • Homology modeling based on related psaF structures from other species

    • Molecular dynamics simulations to assess structural stability changes

    • Free energy perturbation calculations to quantify energetic effects of mutations

  • Functional Impact Prediction:

    • Electrostatic surface mapping to predict changes in interaction interfaces

    • Molecular docking studies with known interaction partners (e.g., plastocyanin)

    • Quantum mechanical calculations for residues involved in electron transfer

  • Integration with Experimental Validation:

    • Virtual screening of mutation effects followed by targeted experimental validation

    • Iterative refinement of computational models based on experimental results

    • Development of specialized force fields for photosystem proteins

These computational approaches can guide experimental design by identifying the most promising mutations for functional studies and providing mechanistic hypotheses about how specific residues contribute to psaF function in photosystem I. The conserved 17-amino acid hydrophobic region in the C-terminal part would be of particular interest for such analyses .

What are common challenges in obtaining functionally active recombinant psaF and how can they be addressed?

Researchers often encounter several challenges when working with recombinant G. tenuistipitata var. liui psaF protein. The following table outlines common issues and recommended solutions:

ChallengePossible CausesRecommended Solutions
Low expression yieldCodon bias in E. coliUse codon-optimized synthetic gene; try expression strains with rare tRNAs
Toxicity to host cellsUse tightly regulated induction systems; lower induction temperature (16-20°C)
Protein degradationAdd protease inhibitors; use protease-deficient host strains
Inclusion body formationImproper foldingLower induction temperature; co-express molecular chaperones
Hydrophobic regionsExpress as fusion with solubility-enhancing tags (MBP, SUMO)
High expression rateReduce inducer concentration; use auto-induction media
Improper foldingAbsence of membrane environmentExpress in cell-free systems with added liposomes or nanodiscs
Missing post-translational modificationsConsider eukaryotic expression systems when necessary
Incorrect disulfide formationAdd oxidizing agents; co-express disulfide isomerases
Low purity after purificationNon-specific binding to resinOptimize imidazole concentration in wash buffers
Protein aggregationInclude mild detergents in buffers; optimize pH and salt concentration
Co-purifying contaminantsAdd secondary purification steps (ion exchange, size exclusion)
Loss of activity during storageFreeze-thaw damageAliquot protein before freezing; add cryoprotectants (glycerol, trehalose)
OxidationAdd reducing agents; store under nitrogen
Proteolytic degradationAdd protease inhibitors; filter sterilize solutions

By systematically addressing these challenges, researchers can improve both the yield and functional quality of recombinant psaF preparations. For specific applications requiring fully functional protein, it may be necessary to validate the recombinant protein against native psaF isolated from G. tenuistipitata var. liui .

How can researchers optimize experimental conditions for studying psaF interactions with other photosystem components?

Optimizing experimental conditions for studying interactions between recombinant G. tenuistipitata var. liui psaF and other photosystem components requires careful consideration of multiple factors:

  • Buffer composition optimization:

    • Screen different pH values (typically 6.5-8.0) to match the native thylakoid environment

    • Test various salt concentrations to balance solubility with native-like ionic strength

    • Include appropriate detergents at concentrations above their critical micelle concentration (CMC) but below levels that might disrupt protein-protein interactions

    • Add stabilizing agents such as glycerol (5-10%) to maintain protein stability

  • Experimental parameters for interaction studies:

    • Temperature: Typically 4-25°C to balance interaction kinetics with protein stability

    • Incubation time: Optimize to allow equilibrium formation without protein degradation

    • Protein concentrations: Use concentration gradients to establish binding parameters

    • Cofactor requirements: Include necessary ions (Mg²⁺, Ca²⁺) or redox components

  • Detection method considerations:

    • For surface plasmon resonance: Optimize immobilization chemistry to maintain protein orientation

    • For pull-down assays: Use appropriate negative controls and washing stringency

    • For microscale thermophoresis: Ensure labeling doesn't interfere with interaction sites

    • For native gel electrophoresis: Optimize detergent and buffer conditions for complex stability

By systematically optimizing these conditions and validating with known interactions, researchers can develop robust protocols for investigating the role of psaF in photosystem assembly and function. The emphasis should be on maintaining conditions that closely mimic the native membrane environment while allowing sensitive detection of specific interactions .

What emerging technologies might advance our understanding of G. tenuistipitata var. liui psaF function in photosynthesis?

Several cutting-edge technologies show promise for deepening our understanding of G. tenuistipitata var. liui psaF function in photosynthesis:

  • Cryo-electron tomography:
    This technique allows visualization of photosystem complexes in their native membrane environment, potentially revealing how psaF is positioned and interacts with other components in intact thylakoid membranes.

  • Time-resolved spectroscopy:
    Advanced ultrafast spectroscopic methods can track electron movement through the photosystem at femtosecond to millisecond timescales, allowing researchers to determine precisely how psaF contributes to electron transfer kinetics.

  • In-cell NMR spectroscopy:
    This emerging technique might enable studies of psaF structure and dynamics within living cells, providing insights into its behavior in the native cellular environment.

  • Single-molecule fluorescence techniques:
    These approaches can reveal the dynamics of individual protein complexes, allowing researchers to observe heterogeneity in behavior that might be masked in bulk measurements.

  • Integrative structural biology:
    Combining multiple structural techniques (X-ray crystallography, NMR, cryo-EM, computational modeling) can provide comprehensive models of how psaF functions within the photosystem complex.

  • CRISPR-based genome editing in algae:
    As gene editing technologies become more accessible for algal systems, direct manipulation of the psaF gene in G. tenuistipitata var. liui could enable precise functional studies in the native organism.

  • Synthetic biology approaches:
    Building minimal photosynthetic systems with defined components could help elucidate the essential contributions of psaF to photosystem function.

These emerging technologies promise to provide unprecedented insights into the structure, dynamics, and function of psaF in photosynthesis, potentially leading to applications in synthetic photosynthesis and bioenergy production .

How might research on G. tenuistipitata var. liui psaF contribute to understanding stress adaptation in photosynthetic organisms?

Research on G. tenuistipitata var. liui psaF may significantly contribute to our understanding of stress adaptation in photosynthetic organisms through several research avenues:

  • Comparative stress responses:
    Red algae like G. tenuistipitata inhabit dynamic intertidal environments and have evolved robust mechanisms to cope with fluctuating conditions. Studying how psaF function is maintained under stress conditions might reveal adaptation strategies relevant to other photosynthetic organisms.

  • Role in biostimulant applications:
    Recent studies have shown that extracts from G. tenuistipitata var. liui can improve drought tolerance in plants like soybean . Further research could determine whether psaF or its derivatives contribute to these beneficial effects, potentially leading to development of specific protein-based biostimulants.

  • Photosystem I stability under stress:
    Investigating how G. tenuistipitata var. liui psaF contributes to photosystem I stability under various stress conditions (high light, temperature extremes, osmotic stress) could reveal mechanisms that maintain photosynthetic efficiency during environmental challenges.

  • Evolutionary adaptations in photosynthesis:
    Comparing psaF from G. tenuistipitata var. liui with homologs from organisms adapted to different environments might identify structural and functional adaptations that contribute to stress resilience.

  • Synthetic biology applications:
    Engineering stress-tolerant features identified in G. tenuistipitata var. liui psaF into crop plants could potentially improve their resilience to environmental stressors, addressing challenges related to climate change and food security.

These research directions could not only advance fundamental understanding of photosynthetic adaptation but also contribute to practical applications in agriculture and biotechnology .

What are the most significant unanswered questions about G. tenuistipitata var. liui psaF that merit future research?

Despite advances in our understanding of G. tenuistipitata var. liui psaF, several significant questions remain unanswered and merit dedicated research efforts:

  • Structural determinants of function:
    What specific structural features of G. tenuistipitata var. liui psaF contribute to its function in red algal photosynthesis, and how do these differ from green lineage homologs?

  • Evolutionary adaptation:
    How has the psaF protein evolved specifically in red algae to function in their unique photosynthetic apparatus, and what can this tell us about the evolution of photosynthesis across diverse lineages?

  • Interaction network:
    What is the complete set of protein-protein interactions involving psaF in G. tenuistipitata var. liui, and how do these interactions modulate photosystem assembly and function?

  • Stress response role:
    Does psaF play a specific role in the adaptation of G. tenuistipitata var. liui to environmental stressors, and could this explain some of the beneficial effects of red algal extracts on plant stress tolerance?

  • Post-translational regulation:
    What post-translational modifications regulate psaF function in vivo, and how do these modifications change in response to environmental conditions?

  • Biotechnological applications:
    Can insights from G. tenuistipitata var. liui psaF be harnessed to improve photosynthetic efficiency or stress tolerance in crop plants or biofuel-producing organisms?

Addressing these questions will require interdisciplinary approaches combining molecular biology, structural biology, evolutionary analysis, and systems biology. The answers may provide not only fundamental insights into photosynthesis but also practical applications in agriculture and biotechnology .

How does research on recombinant G. tenuistipitata var. liui psaF contribute to broader understanding of photosynthetic systems?

Research on recombinant G. tenuistipitata var. liui psaF contributes to our broader understanding of photosynthetic systems in several important ways:

  • Evolutionary perspective:
    Red algae like G. tenuistipitata represent an ancient photosynthetic lineage, and studying their photosystem components provides unique evolutionary insights. The plastid genome of G. tenuistipitata var. liui contains the most complete repertoire of plastid genes known in photosynthetic eukaryotes, offering a window into ancient photosynthetic mechanisms .

  • Diversity of photosynthetic strategies:
    Comparing psaF function across diverse photosynthetic organisms helps elucidate both conserved mechanisms and lineage-specific adaptations in photosynthesis, contributing to a more comprehensive understanding of photosynthetic diversity.

  • Structure-function relationships:
    Detailed analysis of recombinant psaF allows researchers to correlate specific structural features with functional properties, advancing our fundamental understanding of how photosystem components work together to convert light energy to chemical energy.

  • Applied photosynthesis research:
    Insights from G. tenuistipitata var. liui psaF research may inform efforts to engineer photosynthesis for improved efficiency or novel applications, potentially contributing to bioenergy production and sustainable agriculture.

  • Systems biology of photosynthesis: Understanding how psaF integrates into the complex network of photosynthetic proteins helps build more complete models of photosynthesis as a system, rather than as isolated components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.