Recombinant Gracilaria tenuistipitata var. liui Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Grc000160; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
psaL
Target Protein Sequence
MSDFIQSYNNDPFLGNLSTPVSTSTFTKGLLNNLPAYRRGLSPLLRGLEIGMAHGYFLVG PFDKLGPLRNTDVALLSGFLSAVGLIIILTVCLSMYGNVSFDKDDAKDLLQTTEGWGQFT AGFLVGAVGGSGFAYLLLANIPVLQNLGLS
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural role of PsaL in the Photosystem I complex?

    PsaL (Photosystem I reaction center subunit XI) is located at the periphery of the PSI complex. Based on studies of photosystem components, PsaL plays a crucial structural role in the organization of PSI. This subunit is particularly important for the formation of PSI trimers in cyanobacteria, though its specific function may vary slightly in red algae like Gracilaria tenuistipitata var. liui .

    The functional assembly of Photosystem I involves multiple protein subunits working in concert:

    PSI ComponentFunctionEC Number
    PsaAReaction center subunit A1None
    PsaBReaction center subunit A2None
    PsaCIron-sulfur center subunit VIINone
    PsaLReaction center subunit XINone
    PsaKReaction center subunit XNone
    PsaMReaction center subunit XIINone

    While PsaK has been shown to be involved in the interaction of PSI with its external antenna system in higher plants, PsaL's function relates more to the core stability and oligomerization state of the complex .

  • How is the psaL gene organized in the plastid genome of Gracilaria tenuistipitata var. liui?

    The psaL gene is encoded in the plastid genome of Gracilaria tenuistipitata var. liui. The complete plastid genome of G. tenuistipitata var. liui has been sequenced and is approximately 183,883 bp in size, which is consistent with the typical size range of red algal plastid genomes (150-191 kbp) .

    The gene arrangement in the plastid genome follows a specific organization where photosystem genes, including psaL, are clustered in operons. This organization facilitates coordinated expression of photosynthetic components. The plastid genome annotation was performed using tools such as DOGMA with a cutoff e-value of 10^-20 for BLAST hits, followed by manual verification .

  • What approaches can be used to study genetic variation in Gracilaria tenuistipitata populations?

    Multiple molecular approaches have been successfully employed to study genetic variation in Gracilaria tenuistipitata:

    • Mitochondrial cox1 gene analysis: This has been widely used to identify haplotypes and genetic relationships among G. tenuistipitata populations. Studies have identified multiple haplotypes (e.g., T1-T5) using this marker .

    • Microsatellite (SSR) markers: These have shown varying degrees of polymorphism. For example, primer-pair GT5 derived from the chloroplast genome has successfully differentiated G. tenuistipitata specimens from different geographic locations .

    • Chloroplast genome analysis: Complete plastid genome sequencing provides comprehensive genetic information, including for photosystem genes like psaL .

    A methodology for genetic analysis typically involves:

    1. DNA extraction from fresh or preserved algal tissue

    2. PCR amplification of target regions (cox1, SSR loci, or plastid genes)

    3. Sequencing or fragment analysis

    4. Bioinformatic analysis including alignment, phylogenetic reconstruction, and population genetic analysis

Advanced Research Questions

  • What are the optimal conditions for expressing recombinant PsaL from Gracilaria tenuistipitata var. liui in heterologous systems?

    While the search results don't provide specific protocols for recombinant expression of PsaL from G. tenuistipitata var. liui, a research-based approach would include:

    1. Gene optimization: The psaL gene sequence should be codon-optimized for the expression host (typically E. coli, yeast, or insect cells).

    2. Expression system selection:

      • Bacterial systems (E. coli) offer high yields but may lack post-translational modifications

      • Eukaryotic systems (yeast, insect cells) may provide better folding for membrane proteins

    3. Solubilization strategies: As PsaL is a membrane protein, specific detergents or amphipols should be used for extraction and purification:

      • n-Dodecyl β-D-maltoside (DDM)

      • n-Octyl β-D-glucopyranoside (OG)

      • Digitonin for native-like membrane protein extraction

    4. Purification approach: Typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography.

    5. Functional validation: Spectroscopic methods (circular dichroism, fluorescence) to confirm proper folding and potential reconstitution assays with other PSI components .

  • How do genetic variations in PsaL correlate with photosynthetic efficiency across different Gracilaria tenuistipitata populations?

    Research addressing this question would require an integrated approach:

    1. Haplotype identification: Multiple haplotypes of G. tenuistipitata have been identified across Southeast Asia, with varying genetic diversity. For example, Chinese populations showed higher haplotype diversity (Hd = 0.564–0.833) than Vietnamese populations (Hd = 0.186–0.556) .

    2. Gene sequence analysis: Specific examination of psaL sequences across these populations to identify non-synonymous substitutions that might affect protein function.

    3. Photosynthetic measurements: Comparative analysis of:

      • Oxygen evolution rates

      • Chlorophyll fluorescence parameters (Fv/Fm, ETR)

      • P700 oxidation-reduction kinetics specific to PSI function

    4. Structure-function correlation: Using homology modeling to predict how genetic variations might affect PsaL structure and its interaction with other PSI subunits.

    Such research could reveal whether specific haplotypes demonstrate adaptive advantages in photosynthetic performance, particularly under stress conditions like those studied in agricultural applications of G. tenuistipitata extracts .

  • What techniques can be used to study the interaction between recombinant PsaL and other Photosystem I components?

    Several advanced biophysical and biochemical techniques can be employed:

    1. Co-immunoprecipitation (Co-IP): Using antibodies against PsaL to pull down interacting partners.

    2. Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between PsaL and other PSI subunits.

    3. Cryo-electron microscopy (Cryo-EM): For structural determination of the entire PSI complex, revealing the position and interactions of PsaL.

    4. Cross-linking mass spectrometry (XL-MS): To identify specific amino acid residues involved in subunit interactions.

    5. Single-molecule FRET: To study dynamic interactions between labeled subunits.

    6. Reconstitution assays: Sequential addition of purified components to assess assembly hierarchy and functional recovery.

    The complete subunit composition of Photosystem I includes multiple interacting proteins:

    PSI ComponentFunctionInteraction Partners
    PsaA, PsaBCore reaction centerPsaL, PsaI, PsaM
    PsaCFe-S centerPsaA, PsaB, PsaD
    PsaLReaction center subunit XIPsaA, PsaB, PsaI, PsaM
    PsaKReaction center subunit XPsaA, light-harvesting complexes

    Understanding these interactions is critical for elucidating the assembly and function of the photosynthetic apparatus in G. tenuistipitata var. liui .

  • How does the phylogenetic context of Gracilaria tenuistipitata var. liui inform our understanding of PsaL evolution?

    A comprehensive phylogenetic analysis would involve:

    1. Comparative genomics approach:

      • Aligning psaL sequences from multiple red algal species, including the five published red algal plastid genomes .

      • Analyzing selection pressures using dN/dS ratios to identify conserved functional domains.

    2. Phylogeographic context:

      • G. tenuistipitata populations show distinct latitudinal haplogroups (northern, central, and southern) that have been shaped by climate and ocean currents .

      • The genetic makeup of G. tenuistipitata from Singapore is largely similar to Malaysian populations but differs from Thai and Vietnamese populations .

    3. Evolutionary timeline analysis:

      • Bayesian Skyline Plot analysis has revealed a gradual demographic expansion of G. tenuistipitata in the middle Pleistocene without signature of bottlenecks .

      • This contrasts with most marine seaweeds in temperate regions that exhibit bottlenecks associated with low sea-level stands .

    4. Functional domain conservation:

      • Identifying which regions of PsaL are most conserved across evolutionary distance.

      • Correlating conservation patterns with known functional domains for light harvesting and energy transfer.

    This evolutionary context provides critical insight into how photosynthetic machinery has adapted to different environments over time .

  • What are the methodological challenges in purifying functional recombinant PsaL protein?

    Purification of functional membrane proteins like PsaL presents several specific challenges:

    1. Protein stability issues:

      • Membrane proteins are often unstable when removed from their lipid environment

      • Solution: Use of lipid nanodiscs or amphipols to maintain native-like membrane environment

    2. Protein solubility challenges:

      • Hydrophobic transmembrane domains tend to aggregate

      • Solution: Careful optimization of detergent type and concentration (typically DDM or OG at 1-2% for extraction, 0.05-0.1% for purification)

    3. Co-factor retention:

      • PsaL coordinates chlorophyll molecules that may be lost during purification

      • Solution: Purification under dim green light and addition of stabilizing agents

    4. Functional validation protocols:

      • Traditional enzyme assays aren't applicable to structural proteins like PsaL

      • Solution: Circular dichroism to verify secondary structure content, fluorescence to assess chlorophyll binding, and reconstitution experiments

    5. Expression challenges:

      • Low yield in heterologous systems due to toxicity or improper folding

      • Solution: Use of specialized strains (C41/C43 for E. coli) or cell-free expression systems

    Researchers must optimize each of these parameters specifically for G. tenuistipitata var. liui PsaL, which may have unique structural features compared to model organisms .

  • How can CRISPR-Cas9 be utilized to study PsaL function in Gracilaria tenuistipitata var. liui?

    While CRISPR-Cas9 gene editing in red algae is still developing, a methodological approach would include:

    1. Delivery system optimization:

      • Biolistic transformation (gene gun) has shown success in some red algae

      • Electroporation protocols adapted for thick cell walls

      • Agrobacterium-mediated transformation as an alternative approach

    2. Guide RNA design considerations:

      • Target unique regions of the psaL gene to prevent off-target effects

      • Account for the high GC content often found in red algal genomes

      • Design multiple gRNAs targeting different exons for increased editing efficiency

    3. Phenotypic analysis of mutants:

      • Photosynthetic performance measurements (oxygen evolution, P700 oxidation)

      • Growth rate analysis under various light conditions

      • Protein complex assembly studies using Blue-Native PAGE

    4. Complementation studies:

      • Re-introduction of wild-type or modified psaL to confirm phenotype causality

      • Introduction of psaL variants from other species to study functional conservation

    5. Challenges specific to Gracilaria:

      • Polyploidy in some strains may complicate complete gene knockout

      • Regeneration protocols need optimization for each specific variety

    This approach would provide unprecedented insights into PsaL function in this economically important red algal species .

  • How does the genetic diversity of Gracilaria tenuistipitata var. liui affect expression and function of photosystem components?

    This complex question requires integrating population genetics with functional genomics:

    1. Population-level genetic analysis:

      • Studies have identified multiple haplotypes with geographic distribution patterns:

      • T1 haplotype found in Singapore (Ubin Island, Lim Chu Kang, Pasir Ris Park) and Malaysia (Middle Banks)

      • T2 haplotype detected in Batu Laut, Malaysia

      • T3 haplotype from Pattani, Thailand

      • T5 haplotype from Quy Kim, Vietnam

    2. Correlation with photosynthetic parameters:

      • Comparative photosynthetic efficiency measurements across populations

      • Analysis of how genetic variants affect protein expression levels

    3. Environmental adaptation signatures:

      • PsaL sequence variations may reflect adaptation to different light environments

      • Gene expression analysis under stress conditions (temperature, salinity, light)

    4. Molecular consequences of genetic variation:

      Population SourceHaplotypeKey MutationsPotential Functional Impact
      Singapore & MalaysiaT1Reference sequenceBaseline function
      Batu Laut, MalaysiaT2G→A at position 190May affect mRNA stability
      Pattani, ThailandT3C→T at 225, T→C at 1125, G→A at 1203Potential codon usage effects
      Quy Kim, VietnamT5A→G at 174, T→C at 1179Could impact translation efficiency

    Understanding this diversity has implications for selecting optimal strains for recombinant protein production and provides insight into photosynthetic adaptation mechanisms .

Research Application Questions

  • What biotechnological applications could benefit from recombinant PsaL protein from Gracilaria tenuistipitata var. liui?

    Several promising research applications exist:

    1. Bioenergy research:

      • PsaL's role in PSI complex assembly makes it valuable for designing enhanced photosynthetic systems

      • Potential incorporation into bio-hybrid devices for light energy capture

    2. Structural biology research:

      • As a component for reconstitution of complete PSI complexes for structural studies

      • Investigation of protein-protein interactions in membrane protein complexes

    3. Evolutionary biology applications:

      • Using recombinant PsaL variants to study photosystem evolution across algal lineages

      • Structure-function relationship studies through chimeric proteins

    4. Biotechnology platforms:

      • Development of algae-based biosensors for environmental monitoring

      • Enhancement of photosynthetic efficiency in biofuel-producing organisms

    This research direction bridges fundamental photosynthesis research with potential applications in sustainable biotechnology .

  • How does the genetic variation in psaL correlate with the biostimulant properties of Gracilaria tenuistipitata extracts?

    While direct links between psaL variants and biostimulant properties haven't been established, a methodological approach would include:

    1. Extract characterization:

      • Chemical analysis of extracts from different G. tenuistipitata haplotypes

      • Correlation of extract composition with genetic variants

    2. Controlled growth studies:

      • Testing extracts from various haplotypes on model plants (e.g., soybeans)

      • Studies have shown that G. tenuistipitata extracts at 5.0% and 10.0% (v/v) can improve drought tolerance in soybeans

    3. Specific bioactive compound identification:

      • Fractionation and bioassay-guided purification

      • Correlation with photosynthetic efficiency in the source algae

    4. Proposed mechanisms:

      • Enhanced photosynthetic capacity may contribute to increased bioactive compound production

      • Variations in stress response pathways could affect secondary metabolite profiles

    This research direction connects fundamental photosystem research with agricultural applications, potentially leading to optimized biostimulant products for specific growing conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.