Recombinant Gracilaria tenuistipitata var. liui Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Grc000024; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWERFCTWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDI DGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVSCYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANNGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWFTAMSVSTMAFNLNGF NFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that fuels ATP formation. It comprises a core antenna complex for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein (psbA) in Gracilaria tenuistipitata var. liui?

The Photosystem Q(B) protein, also known as D1 protein or 32 kDa thylakoid membrane protein, is encoded by the psbA gene in the plastid genome of Gracilaria tenuistipitata var. liui, a red alga . This protein forms an essential component of Photosystem II (PSII), specifically part of the reaction center where primary photochemistry occurs . The protein contains 344 amino acids and has a Uniprot accession number of Q6B929 .

In Photosystem II, the D1 protein (along with D2) binds the P680 reaction center chlorophyll special pair and supports the primary electron transfer chain, including plastoquinones . The D1 protein is particularly noteworthy because it undergoes routine damage from reactive oxygen species during normal photosynthesis and must be frequently replaced through an intricate repair process to maintain photosynthetic efficiency .

How does the psbA gene from Gracilaria tenuistipitata var. liui compare to those in other organisms?

The psbA gene from Gracilaria tenuistipitata var. liui is part of a circular plastid genome of 183,883 bp, which was the first plastid genome sequenced from the subclass Florideophycidae (Rhodophyta) . Comparative analyses with other red algae such as Porphyra pupurea reveal strong conservation of gene content and order, though there are major genomic rearrangements and Gracilaria-specific coding regions .

Research indicates that Gracilaria maintains a surprisingly ancient gene content in its plastid genome and, along with other Rhodophyta, contains one of the most complete repertoires of plastid genes known in photosynthetic eukaryotes . This makes its psbA gene particularly valuable for evolutionary studies and understanding the ancestral state of photosynthetic machinery.

Gracilaria tenuistipitata var. liui's plastid genome contains 238 predicted genes with only a single copy of the ribosomal RNA operon, demonstrating evolutionary conservation while maintaining species-specific adaptations . These characteristics position the psbA gene as an important marker for understanding photosynthetic evolution across diverse lineages.

What is the structure and function of the D1 protein in Photosystem II?

The D1 protein (psbA gene product) forms an integral part of the reaction center (RC) of Photosystem II, partnering with the D2 protein to create the core of photochemical activity . Structurally, D1 is membrane-intrinsic within the thylakoid membrane, containing binding sites for the P680 chlorophyll special pair and integration with the primary electron transfer chain components, including association with plastoquinones (particularly QA and QB) .

Functionally, the D1 protein is central to the water-splitting and oxygen-evolving capabilities of Photosystem II. It participates in light harvesting and energy transfer to the reaction center, charge separation in the P680 special pair, electron transport from water to plastoquinone, and support of the manganese cluster that catalyzes water oxidation .

The D1 protein experiences particularly high rates of photodamage due to its central role in electron transport and proximity to reactive oxygen species generation sites . This vulnerability necessitates a continuous repair cycle involving proteolytic degradation of damaged D1 and insertion of newly synthesized protein into the PSII complex, making it one of the most dynamic components of the photosynthetic apparatus.

What genomic context surrounds the psbA gene in Gracilaria tenuistipitata var. liui?

The psbA gene in Gracilaria tenuistipitata var. liui exists within a circular plastid genome of 183,883 bp containing 238 predicted genes . This genomic context provides important evolutionary insights, as the gene exists in an environment that has undergone both conservation and significant rearrangements compared to other red algal species like Porphyra pupurea .

Key features of this genomic context include the presence of a single copy of the ribosomal RNA operon, conservation of many gene content and order features with other red algae, evidence of major genomic rearrangements specific to Gracilaria, and the existence of coding regions that are specific to Gracilaria . These characteristics highlight the unique evolutionary history of this plastid genome.

The genomic positioning of psbA within this ancient yet specialized genome provides researchers with a valuable window into plastid evolution in red algae. The conservation of gene content amid structural rearrangements suggests selective pressure to maintain photosynthetic function while allowing genomic flexibility in other areas, creating a fascinating system for evolutionary genomics studies.

What methodological approaches are most effective for expressing and purifying recombinant Gracilaria tenuistipitata var. liui D1 protein?

Expression and purification of recombinant D1 protein from Gracilaria tenuistipitata var. liui presents several unique challenges due to its hydrophobic nature and complex folding requirements. Methodological approaches must address these challenges through specialized expression systems and purification strategies.

For expression, researchers should consider bacterial systems (E. coli) modified with rare codon supplementation, cell-free expression systems that bypass inclusion body formation, or yeast expression systems (P. pastoris) for proper post-translational modifications. Each system offers different advantages depending on research goals and available resources.

Purification strategies should employ mild detergents (n-dodecyl-β-D-maltoside) for membrane protein extraction, affinity chromatography utilizing engineered tags that can be later removed, and size exclusion chromatography for final purification steps. For optimal results, expression should be conducted at lower temperatures (16-20°C) to facilitate proper folding .

The purified recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles significantly impact protein stability and activity, so working aliquots should be maintained at 4°C for up to one week during active experimentation phases .

How can researchers effectively analyze the structural integrity and functional activity of recombinant D1 protein?

Assessing the structural integrity and functional activity of recombinant D1 protein requires a multi-faceted approach combining both structural and functional analysis methods. For structural analysis, researchers should employ circular dichroism (CD) spectroscopy to confirm secondary structure elements, limited proteolysis to assess protein folding quality, thermal shift assays to determine protein stability, and potentially NMR spectroscopy for detailed structural investigations in solution.

Functional assessment requires techniques such as reconstitution assays with other PSII components, electron transport measurements using artificial electron acceptors, chlorophyll fluorescence quenching analysis, and oxygen evolution measurements in reconstituted systems. These approaches provide complementary information about protein function.

A critical consideration when working with recombinant D1 protein is verifying its binding capacity for essential cofactors, particularly chlorophyll and plastoquinones. Absorbance spectroscopy can confirm chlorophyll association, while EPR spectroscopy can verify proper electron transfer capabilities. These spectroscopic methods should be combined with functional assays to provide a comprehensive assessment of protein activity.

For thorough characterization, researchers should implement both in vitro assays measuring isolated protein activity and reconstitution experiments that assess the protein's ability to integrate into functional PSII complexes. This dual approach ensures that both intrinsic protein properties and interaction capabilities are properly evaluated.

What insights can comparative studies between Gracilaria tenuistipitata var. liui D1 protein and homologs from other photosynthetic organisms provide?

Comparative studies between the D1 protein from Gracilaria tenuistipitata var. liui and those from other photosynthetic organisms offer valuable insights into evolutionary adaptation, functional conservation, and structural requirements for photosynthesis. These studies can be approached through multiple complementary methodologies.

Sequence-based comparative analyses should include multiple sequence alignments to identify conserved domains and species-specific variations, phylogenetic analyses to establish evolutionary relationships, identification of selection pressures acting on specific regions of the protein, and correlation of sequence variations with habitat-specific adaptations. These approaches reveal evolutionary patterns and functional constraints.

Structural comparative studies can utilize homology modeling based on available crystal structures, comparison of predicted binding sites for cofactors and interaction partners, analysis of structural elements associated with stability in different environments, and investigation of species-specific structural adaptations. These structural insights connect sequence variation to functional differences.

These comparative approaches are particularly valuable given that Gracilaria tenuistipitata var. liui, as a red alga, maintains a surprisingly ancient gene content in its plastid genome and contains one of the most complete repertoires of plastid genes known in photosynthetic eukaryotes . This evolutionary position makes it an excellent subject for understanding the ancestral state of the photosynthetic apparatus and how it has diverged in different lineages.

How does the D1 protein interact with assembly factors during Photosystem II biogenesis in red algae?

The biogenesis of Photosystem II involves numerous assembly factors that facilitate proper component integration. While specific data on red algal systems is limited, research on other photosynthetic organisms provides a framework for understanding D1 protein interactions during PSII assembly in Gracilaria tenuistipitata var. liui.

During pre-D1 processing, the protein likely interacts with CtpA protease for C-terminal processing, with Psb27 potentially facilitating access of CtpA to pre-D1, and PratA possibly involved in Mn²⁺ loading to D1 . In early assembly stages, D1 associates with factors like RubA before D2 association, interacts with Ycf48 during insertion and chlorophyll incorporation, and may be assisted by HliC/ScpB and HliD/ScpE in chlorophyll insertion .

During reaction center formation, D1 interacts with factors like PsbN and PsbP, associates with various low molecular weight subunits, and integrates with the D2 protein to form the reaction center core . This process continues as the D1/D2 reaction center joins with the CP47 pre-complex to form the RC47 complex.

The table below summarizes key assembly factors likely to interact with D1 during PSII biogenesis:

Assembly FactorFunctionInteraction Stage with D1
CtpAC-terminal processing of D1Pre-integration processing
RubAD1/D2 assemblyEarly assembly
Ycf48Insertion of D1, chlorophyll into D1Early assembly
PratAMn²⁺ loading to D1Pre-integration processing
Psb27Facilitates access of CtpA to pre-D1Pre-integration processing
HliC/ScpBChlorophyll insertionEarly assembly
HliD/ScpEChlorophyll insertionEarly assembly
PsbNRC formationRC assembly
PsbPRC formationRC assembly

What protocols optimize experimental outcomes when working with recombinant Gracilaria tenuistipitata var. liui D1 protein?

Working with recombinant Gracilaria tenuistipitata var. liui D1 protein requires specialized protocols to address its membrane-intrinsic nature and susceptibility to denaturation. Several key methodological considerations help optimize experimental outcomes.

For sample preparation, researchers should store stock protein at -20°C or -80°C in 50% glycerol Tris-based buffer , prepare working aliquots at 4°C and use within one week, avoid repeated freeze-thaw cycles to preserve protein integrity , and when thawing frozen samples, do so rapidly in a room temperature water bath before immediate transfer to ice. These handling practices significantly impact protein stability.

Buffer optimization requires including glycerol (10-20%) in all working buffers to maintain protein stability, maintaining pH between 6.5-7.5 to mimic the native thylakoid environment, including low concentrations of non-ionic detergents to prevent aggregation, and considering adding reducing agents to prevent oxidation of sensitive residues. These buffer components help maintain native-like protein conformation.

Experimental conditions should be carefully controlled by conducting experiments in dim green light to minimize photodamage, maintaining temperature control during all procedures (typically 4-25°C), measuring protein concentration using methods compatible with membrane proteins and detergents, and pre-equilibrating all experimental apparatus with buffer containing similar detergent concentrations. These precautions minimize experimental artifacts and improve reproducibility.

How can researchers effectively use recombinant D1 protein in reconstitution studies of Photosystem II?

Reconstitution studies represent a powerful approach for investigating structure-function relationships of Photosystem II components. When using recombinant Gracilaria tenuistipitata var. liui D1 protein for such studies, researchers should implement systematic methodological approaches.

Preparation of liposomes or nanodiscs should involve selecting lipid compositions that mimic the thylakoid membrane environment, optimizing protein-to-lipid ratios to prevent aggregation while ensuring sufficient protein density, using controlled detergent removal techniques like dialysis or bio-beads, and verifying successful incorporation using freeze-fracture electron microscopy or dynamic light scattering. This creates an appropriate membrane environment for protein function.

A stepwise reconstitution strategy should begin with D1 and D2 proteins to form the reaction center core, add cytochrome b559 components, incorporate chlorophyll-binding antenna proteins (CP47, CP43), add low molecular weight subunits, and finally add extrinsic proteins of the oxygen-evolving complex. This sequential approach mimics the natural assembly process.

Cofactor integration requires adding chlorophyll during the reconstitution process (not afterward), ensuring proper incorporation of plastoquinones (particularly QA and QB), including manganese, calcium, and chloride ions for assembly of the oxygen-evolving complex, and monitoring binding of cofactors spectroscopically during the reconstitution process. These cofactors are essential for functional activity.

Functional assessment should measure chlorophyll fluorescence to assess energy transfer efficiency, evaluate electron transport capabilities using artificial electron acceptors, measure oxygen evolution to confirm complete functional assembly, and use EPR spectroscopy to verify proper formation of redox-active centers. These measurements confirm successful reconstitution of functional complexes.

What analytical techniques provide the most informative data about D1 protein structure and function?

To comprehensively characterize the structure and function of recombinant Gracilaria tenuistipitata var. liui D1 protein, researchers should employ multiple complementary analytical techniques that provide different types of information about the protein.

Structural analysis techniques include crystallography and cryo-EM to provide high-resolution structural information (though these may need to be performed in the context of the PSII complex), spectroscopic methods like circular dichroism for secondary structure assessment and fluorescence spectroscopy for monitoring chlorophyll binding, and mass spectrometric approaches such as hydrogen-deuterium exchange to map solvent-accessible regions and cross-linking MS to identify interaction interfaces.

Functional analysis techniques should include biophysical methods like EPR spectroscopy to examine redox-active centers and electron transfer, time-resolved fluorescence to measure energy transfer dynamics, flash photolysis to track electron transfer kinetics, and oxygen polarography to quantify oxygen evolution activity. These approaches directly measure functional processes.

Biochemical approaches provide complementary information through co-immunoprecipitation to identify interaction partners, site-directed mutagenesis to examine the role of specific residues, limited proteolysis to probe protein folding and domain organization, and chemical cross-linking to map interaction interfaces. These methods connect structure to function through experimental manipulation.

Computational methods can enhance experimental data through molecular dynamics simulations modeling protein behavior in membrane environments, quantum mechanical calculations examining electron transfer pathways, homology modeling predicting structure based on homologous proteins, and molecular docking investigating small molecule binding. These approaches fill gaps in experimental data and generate testable hypotheses.

What considerations are important when designing site-directed mutagenesis studies of the psbA gene?

Site-directed mutagenesis represents a powerful approach for structure-function analysis of the D1 protein. When designing such studies for the Gracilaria tenuistipitata var. liui psbA gene, researchers should consider several methodological aspects to maximize the informational value of their experiments.

Target selection strategy should focus on highly conserved residues identified through multiple sequence alignments, target residues implicated in cofactor binding (chlorophyll, plastoquinone), examine residues at protein-protein interfaces with other PSII components, and investigate residues susceptible to oxidative damage and photoinhibition. This targeted approach addresses specific hypotheses about protein function.

Mutagenesis approach selection depends on experimental goals: QuikChange or overlap extension PCR methods for single mutations, Golden Gate assembly or Gibson Assembly for multiple mutations, CRISPR-based saturation mutagenesis for scanning mutagenesis, and codon optimization for expression in heterologous systems. The approach should match the specific research question.

Mutation type considerations should include conservative substitutions (preserving chemical properties) to examine subtle effects, non-conservative substitutions to drastically alter properties at specific sites, alanine scanning to neutralize side-chain contributions, and potentially the introduction of photo-crosslinkable amino acids to trap transient interactions. These different mutation types provide complementary information.

Expression system selection is critical, with options including cyanobacterial systems for closer native environment, heterologous expression in E. coli for higher yield, cell-free systems for difficult-to-express variants, and consideration of codon usage differences between red algae and expression hosts. The expression system must produce sufficient quantities of properly folded protein for analysis.

What are the promising research avenues for understanding D1 protein turnover in red algal photosynthesis?

The D1 protein undergoes rapid turnover due to photodamage, making this process critical for sustained photosynthetic activity. Future research into D1 protein turnover in Gracilaria tenuistipitata var. liui and other red algae could explore several promising directions.

Investigation of molecular mechanisms of damage and repair should identify red algal-specific proteases involved in D1 degradation, characterize the PSII repair cycle in red algal thylakoid membranes, examine how different light regimes affect D1 turnover rates in red algae, and investigate redox-regulated processes in D1 turnover under various environmental conditions. These studies would reveal the unique aspects of the repair cycle in red algae.

Research into regulatory networks should explore transcriptional regulation of the psbA gene in response to photodamage, post-transcriptional controls affecting D1 synthesis and integration, signaling pathways coordinating chloroplast and nuclear gene expression, and comparison of regulatory mechanisms between red algae and other photosynthetic lineages. This would illuminate how red algae coordinate the complex repair process.

Environmental adaptation studies could analyze D1 turnover under different temperature and salinity conditions relevant to red algal habitats, examine how D1 variants affect thermal tolerance and photoinhibition resistance, investigate seasonal variations in D1 turnover rates in natural populations, and compare across red algal species from different ecological niches. These approaches would reveal how environmental factors shape D1 dynamics.

Technological approaches to advance this research include development of red algal-specific antibodies for tracking D1 protein dynamics, application of pulse-chase labeling techniques to quantify turnover rates, implementation of super-resolution microscopy to visualize repair processes in situ, and utilization of algal gene editing technologies to create reporter systems for monitoring D1 turnover.

How might advances in structural biology techniques enhance our understanding of the Gracilaria tenuistipitata var. liui D1 protein?

Recent advances in structural biology offer unprecedented opportunities to deepen our understanding of the D1 protein from Gracilaria tenuistipitata var. liui. These new approaches could revolutionize our understanding of this protein's structure-function relationships.

Cryo-electron microscopy applications could obtain high-resolution structures of the entire PSII complex from red algae, visualize the D1 protein in different states of the photocycle, capture intermediate states during the PSII assembly process, and examine structural differences between intact and photodamaged D1 protein. These approaches would provide dynamic structural information previously inaccessible.

Integrative structural biology approaches could combine X-ray crystallography, NMR, and cryo-EM data for comprehensive structural models, utilize cross-linking mass spectrometry to map protein-protein interactions within PSII, apply hydrogen-deuterium exchange mass spectrometry to examine dynamic regions, and implement small-angle X-ray scattering to assess conformational changes in solution. This multi-technique approach provides complementary structural insights.

Time-resolved structural techniques could employ time-resolved X-ray free-electron laser studies to capture transient states during photosynthesis, utilize time-resolved cryo-EM to visualize structural changes during electron transfer, apply ultrafast spectroscopy to correlate structural changes with functional events, and implement temperature-jump experiments to examine conformational flexibility. These approaches connect structure to dynamic function.

Computational structure-function analysis could perform molecular dynamics simulations in realistic membrane environments, model electron transfer pathways using quantum mechanical calculations, predict water channels and proton transfer routes through the protein, and simulate the effects of mutations on protein stability and function. These computational approaches extend experimental data and generate new hypotheses.

What potential biotechnological applications exist for recombinant Gracilaria tenuistipitata var. liui D1 protein?

While commercial applications are outside the scope of this academic-focused FAQ, several biotechnological research applications could utilize recombinant Gracilaria tenuistipitata var. liui D1 protein to advance scientific understanding.

As photosynthesis research tools, applications could include development of standardized D1 protein variants as research reagents, creation of biosensors for detecting photosynthesis inhibitors or environmental pollutants, engineering of simplified photosystems for fundamental photochemistry research, and design of experimental platforms for testing artificial photosynthesis components. These tools would enhance basic photosynthesis research.

Structural biology applications could use the protein as a model system for membrane protein crystallization studies, development of improved expression and purification protocols for membrane proteins, application as a test case for new structural biology methods, and creation of chimeric proteins to investigate structure-function relationships. These approaches advance membrane protein methodology.

Evolutionary and comparative research applications include investigation of red algal photosynthetic adaptations, analysis of evolutionary trajectories in photosynthetic proteins, examination of how structural variations affect functional properties, and exploration of convergent evolution in photosynthetic mechanisms. These studies would provide insights into photosynthetic evolution.

Educational and training applications could develop educational kits demonstrating photosynthetic principles, create simplified experimental systems for teaching biochemistry, design modular systems for demonstrating protein engineering principles, and implement accessible systems for demonstrating site-directed mutagenesis. These applications would enhance scientific training and education.

What are the key considerations for researchers working with Recombinant Gracilaria tenuistipitata var. liui Photosystem Q(B) protein?

Researchers working with recombinant Gracilaria tenuistipitata var. liui D1 protein should consider several key factors to ensure successful experiments and reliable results. These considerations span technical, scientific, and application domains.

From a technical perspective, the hydrophobic nature of D1 protein necessitates specialized handling protocols with proper storage conditions (-20°C or -80°C with 50% glycerol) essential for maintaining protein integrity . Experimental work should avoid repeated freeze-thaw cycles and maintain appropriate detergent concentrations, while methodological approaches must account for the protein's susceptibility to photodamage. These technical considerations directly impact experimental success.

In scientific context, researchers should remember that the D1 protein functions as part of the reaction center in Photosystem II, participating in primary photochemistry and electron transport . Gracilaria tenuistipitata var. liui's plastid genome represents an important evolutionary reference point for understanding plastid evolution , and the protein undergoes rapid turnover in vivo due to photodamage, a process critical for maintaining photosynthetic efficiency . These scientific contexts inform experimental design and interpretation.

Regarding research applications, the protein can be used for reconstitution studies to understand PSII assembly and function, site-directed mutagenesis can illuminate structure-function relationships, structural biology approaches can reveal unique adaptations in red algal photosynthesis, and the protein serves as an important model for understanding photosystem repair and maintenance. These diverse applications demonstrate the protein's value as a research tool.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.