The recombinant Gracilaria tenuistipitata var. liui uncharacterized protein ycf92 (UniProt ID: Q6B8Q5) is a full-length protein (1–245 amino acids) derived from the red alga Gracilaria tenuistipitata var. liui. Its recombinant form is produced in E. coli or mammalian cells for research purposes, with commercial availability in lyophilized or glycerol-based formats . Despite its classification as "uncharacterized," proteomic studies suggest potential roles in cellular interactions or stress responses, though definitive functional data remain limited .
Amino Acid Sequence:
MNLSQSFLLNRYIQSPRTWLHRLNSNNKIYFLFFYLSIFPYTDVKYMTYSIIFYTILFLY LKHIDKNYKIFILRIVYKVCIFTLAISCLSKLLLSVNIFRLKYISDFFLNLMSICTRNIL YIRSVLILTHYFCTVHITFMTTTYEDIIFAFIPLFTQYQNNIIKKVAFISIFALQAIENT LIKIYSILITIKMKQFTKVFKFQYYIYIYLILKFIQDIYNDIYRISTVFYVRELNHKMSY FTYIY
Proteomic studies on Gracilaria spp. using LC-HRMS identified peptide sequences (e.g., TKKILDK, TVKSLLTK) with β-sheet and α-helix conformations, suggesting hydrophilic interactions and potential roles in protein-binding or antimicrobial activity . While ycf92’s exact structural role remains unclear, its sequence alignment with Rhodophyta proteins hints at conserved functional domains .
Protein Interactions: β-sheet structures may facilitate hydrogen bonding with receptors, a feature often linked to antimicrobial peptides or signaling molecules .
Stress Response: The high protein content of G. tenuistipitata var. liui (16.55% dry weight) and its use in biostimulants suggest ycf92 may contribute to cellular resilience, though direct evidence is lacking .
Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .
Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .
Functional Elucidation: No studies directly link ycf92 to specific biochemical pathways or phenotypes.
Comparative Analysis: Limited data on ycf92’s homology with proteins in other algae or model organisms.
Field Applications: While G. tenuistipitata extracts show biostimulant potential, ycf92’s role in these effects remains unexplored .
Gracilaria tenuistipitata var. liui is a commercially important red algal species belonging to the Rhodophyta division. It has gradually become a model species for cultivation due to its rapid growth and high agar yield . The species was first formally described by Zhang & Xia in 1988, with the holotype collected from Haikou, Hainan Island, Guangdong Province, China . Its significance for molecular studies stems from its well-characterized genome and the presence of various uncharacterized proteins including those in the ycf family, which provides opportunities for novel protein discovery and characterization. The species exhibits genetic variation across different geographical locations, making it valuable for studying genetic diversity and adaptation mechanisms .
Genetic variation in Gracilaria tenuistipitata is typically analyzed using both nuclear and mitochondrial molecular markers. Researchers commonly employ two primary approaches:
Mitochondrial cox1 gene analysis: This method has proven valuable for studying intraspecific relationships and genetic variation in Gracilaria species. The cox1 gene is considered highly variable and suitable for species identification .
Microsatellite (SSR) marker analysis: Simple Sequence Repeat markers derived from the chloroplast genome are used to detect genetic polymorphism. In studies of G. tenuistipitata, primer pairs such as GT1-GT8 have been utilized, though most show monomorphic results with the exception of markers like GT5, which can differentiate between specimens from different geographical locations .
These analyses typically involve DNA extraction, PCR amplification with specific primers, sequencing, and subsequent phylogenetic analysis using methods such as UPGMA (Unweighted Pair Group Method with Arithmetic Mean) and TCS (Templeton-Crandall-Sing) analysis for haplotype network construction .
The basic approaches for cloning genes from Gracilaria tenuistipitata var. liui involve the following methodological steps:
Spore preparation and DNA extraction:
Gene sequence identification and primer design:
PCR amplification and cloning:
Transformation and verification:
This basic workflow can be adapted for cloning various genes from G. tenuistipitata var. liui, including uncharacterized proteins such as those in the ycf family.
The optimal conditions for recombinant expression of algal proteins from Gracilaria tenuistipitata in bacterial systems require careful optimization of several parameters:
Expression vector selection:
Host strain selection:
Induction optimization:
Protein extraction and analysis:
For algal proteins that may be challenging to express in soluble form, additional strategies may include fusion with solubility-enhancing tags, co-expression with chaperones, or use of specifically engineered E. coli strains designed to enhance protein folding.
Bioinformatic analysis provides crucial insights into the properties and potential functions of uncharacterized proteins like ycf92 from Gracilaria tenuistipitata var. liui. A comprehensive bioinformatic workflow includes:
Primary sequence analysis:
Structural feature prediction:
Post-translational modification prediction:
Subcellular localization prediction:
Functional annotation through:
Gene Ontology term assignment
Protein-protein interaction network prediction
Comparative analysis with characterized proteins from related species
This multi-layered approach provides a foundation for experimental design and can guide targeted studies to validate predicted features and functions of uncharacterized proteins.
Characterizing membrane-associated proteins from algal sources like Gracilaria tenuistipitata presents several methodological challenges that require specialized approaches:
Extraction and solubilization challenges:
Expression system limitations:
Bacterial expression systems may not properly fold algal membrane proteins
Codon usage differences between algae and bacteria may reduce expression efficiency
Post-translational modifications common in algae may be absent in bacterial systems
Alternative expression systems (yeast, insect cells) may be needed for functional expression
Structural analysis complications:
Membrane proteins are difficult to crystallize for X-ray crystallography
Detergents needed for solubilization may interfere with structural studies
Sample preparation for cryo-EM requires specialized approaches
NMR studies require isotope labeling, which may be difficult in non-native expression systems
Functional characterization difficulties:
Transport assays require reconstitution in artificial membrane systems
Interaction partners from the original algal system may be unknown
Functional redundancy may mask phenotypes in knockout/knockdown studies
Species-specific interaction networks may not be well characterized
Addressing these challenges requires integration of multiple approaches, including advanced microscopy techniques, proteoliposome reconstitution, and specialized mass spectrometry methods adapted for membrane proteins.
Genetic variation in Gracilaria tenuistipitata has significant implications for protein expression profiles, including uncharacterized proteins like those in the ycf family:
Population-specific expression patterns:
Studies have identified distinct genetic populations of G. tenuistipitata using both mitochondrial cox1 gene and microsatellite markers
Specimens from Singapore were grouped into two different genotypes using SSR markers, suggesting potential differences in gene expression profiles
Geographical variation may correlate with differential adaptation mechanisms reflected in protein expression
Haplotype-specific protein variants:
Five mitochondrial haplotypes (T1-T5) have been identified in G. tenuistipitata populations from different regions
Specific mutation changes between haplotypes (e.g., guanidine to adenine at position 190, cytosine to thymine at position 225) may alter protein-coding sequences
These genetic differences can potentially result in functional variations in expressed proteins
Implications for recombinant protein expression:
Understanding these genetic diversity patterns provides important context for researchers working with recombinant proteins from this species, as source material selection can significantly impact experimental outcomes.
The most effective techniques for analyzing genetic variation in chloroplast-encoded proteins like ycf92 from Gracilaria tenuistipitata combine genomic, transcriptomic, and proteomic approaches:
Genomic DNA analysis:
Chloroplast genome sequencing provides the foundation for identifying variations
PCR-RFLP (Restriction Fragment Length Polymorphism) can detect major structural variations
Targeted sequencing of chloroplast genes using specific primers (as demonstrated with microsatellite markers in G. tenuistipitata)
Next-generation sequencing approaches for entire chloroplast genome comparison
RNA-based methods:
RT-PCR to assess expression levels across different populations
RNA-Seq to comprehensively analyze transcriptome-wide expression patterns
Differential expression analysis between populations with different genetic backgrounds
Protein-level analysis:
2D gel electrophoresis to compare protein isoforms across populations
Mass spectrometry to identify post-translational modifications
Protein structure analysis to determine functional implications of amino acid substitutions
Population genetics approaches:
The combination of these techniques provides a comprehensive view of genetic variation, from the DNA sequence level to functional protein differences, enabling researchers to understand the evolutionary significance and functional implications of variations in chloroplast-encoded proteins.
Extracting high-quality DNA from Gracilaria tenuistipitata for gene cloning requires specialized protocols that address the challenges presented by algal tissue:
Sample preparation:
Fresh tissue should be cleaned thoroughly to remove epiphytes and contaminants
Flash freezing in liquid nitrogen followed by lyophilization preserves DNA integrity
Mechanical disruption using acid-washed glass beads in a bead grinder is effective for breaking down tough cell walls
Multiple grinding cycles (e.g., 1 minute grinding followed by 5 minutes cooling on ice, repeated 6 times) ensures thorough disruption while preventing heat denaturation
Extraction methodology:
Commercial fungal/plant genomic DNA extraction kits provide reliable results
CTAB (cetyltrimethylammonium bromide) method with modifications for high polysaccharide content
Addition of polyvinylpyrrolidone (PVP) to remove phenolic compounds
Multiple phenol-chloroform extraction steps may be necessary to achieve high purity
DNA purification:
RNase treatment to remove RNA contamination
Ethanol precipitation with sodium acetate for concentration and further purification
Size-selection may be necessary for downstream applications like library preparation
Quality assessment:
Spectrophotometric analysis (260/280 and 260/230 ratios) to assess purity
Gel electrophoresis to evaluate integrity and fragment size
PCR amplification of control genes to confirm suitability for molecular applications
Following extraction, storage at -20°C maintains DNA stability for downstream cloning applications . Researchers should adjust protocols based on the specific characteristics of their samples, particularly when working with specimens from different geographical locations that may have varying biochemical compositions.
Troubleshooting expression problems with recombinant algal proteins like ycf92 from Gracilaria tenuistipitata requires a systematic approach to identify and resolve specific issues:
Low expression yield troubleshooting:
Optimize codon usage for the expression host (E. coli)
Test multiple expression vectors with different promoter strengths
Evaluate different E. coli strains specialized for protein expression
Adjust induction conditions (IPTG concentration, temperature, duration)
Check for toxicity by monitoring growth curves after induction
Protein solubility issues:
Reduce induction temperature (20°C or lower) to slow protein synthesis and improve folding
Co-express with molecular chaperones to assist protein folding
Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)
Add compatible solutes or mild detergents to the growth medium
Consider cell-free expression systems for highly toxic or insoluble proteins
Protein degradation problems:
Add protease inhibitors during extraction and purification
Use E. coli strains deficient in specific proteases (e.g., BL21)
Optimize extraction buffer composition (pH, salt concentration)
Perform extraction at lower temperatures (4°C)
Minimize handling time during purification
Purification challenges:
Optimize lysis conditions (sonication parameters: 250W, 3s pulses with 5s intervals)
Test different buffer systems for improved protein stability
Use affinity chromatography with appropriate tags
Consider on-column refolding for proteins in inclusion bodies
Implement size exclusion chromatography as a final polishing step
Systematic analysis approach:
Analyze each step of the expression process separately
Use SDS-PAGE and Western blotting to track protein throughout the process
Compare multiple expression conditions in parallel small-scale experiments
Document all parameters to identify patterns in successful expressions
This methodical approach allows researchers to identify specific bottlenecks in the expression process and implement targeted solutions.
Designing effective primers for amplifying chloroplast genes from Gracilaria tenuistipitata requires attention to several critical factors:
Target sequence analysis:
Primer design parameters:
Optimal primer length: 18-30 nucleotides
GC content: 40-60% for stable annealing
Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs
Add restriction enzyme sites to facilitate cloning (with additional bases at 5' end for efficient digestion)
Avoid secondary structures, primer-dimers, and self-complementary sequences
Algae-specific considerations:
Account for codon bias in algal genomes
Be aware of AT-rich regions in chloroplast genes that may require special consideration
Check for organelle-specific nuances in genetic code
Consider potential heteroplasmy in chloroplast genomes
Experimental validation strategy:
Design multiple primer pairs for important targets
Include positive controls using previously amplified genes
Optimize PCR conditions (annealing temperature, MgCl₂ concentration, cycle number)
Consider touchdown PCR for difficult templates
Special applications:
Following these guidelines increases the likelihood of successful amplification of chloroplast genes from G. tenuistipitata, providing high-quality template DNA for downstream applications like cloning and expression.
Comparative analysis of ycf92 from Gracilaria tenuistipitata var. liui with homologous proteins from other algal species reveals insights into its potential structure and function:
Sequence conservation patterns:
Alignment of ycf family proteins across red algal species reveals conserved motifs
Conservation analysis identifies functionally important residues maintained through evolutionary pressure
Comparison with homologs from diverse algal lineages helps distinguish red algae-specific features
Structural comparison approaches:
Secondary structure prediction tools identify common structural elements
Transmembrane domain analysis reveals similar membrane topology across related species
Protein modeling using homology-based approaches provides three-dimensional structural insights
Signal peptide comparison helps determine subcellular localization consistency
Functional prediction through comparative genomics:
Synteny analysis examines gene neighborhood conservation across species
Co-expression pattern comparison across diverse algal transcriptomes
Association with specific cellular pathways based on homologs with known functions
Identification of conserved interaction partners through interactome analysis
Evolutionary context:
This comparative approach provides a foundation for hypothesis generation regarding protein function and guides experimental design for functional characterization studies.
For predicting the function of uncharacterized proteins like ycf92 from algal genomes, the following bioinformatic pipeline is recommended:
Initial sequence analysis:
Compute basic protein parameters (molecular weight, isoelectric point) using tools like ExPASy Compute pI/Mw
Perform BLAST searches against multiple databases (nr, SwissProt, model organism databases)
Execute HMM-based searches against specialized databases (PFAM, TIGRFAM)
Identify conserved domains using InterProScan and CDD
Structural feature prediction:
Post-translational modification prediction:
Advanced functional prediction:
Integration and validation:
Combine multiple prediction methods using consensus approaches
Cross-reference predictions with experimental data from related species
Prioritize function predictions based on confidence scores
Design targeted experiments to test specific functional hypotheses
This comprehensive pipeline leverages multiple complementary approaches to overcome limitations of individual methods and provides researchers with testable hypotheses about protein function.
Emerging techniques for studying chloroplast-encoded proteins in red algae like Gracilaria tenuistipitata are advancing our understanding of these important but often uncharacterized proteins:
Advanced genomic approaches:
Long-read sequencing technologies (PacBio, Oxford Nanopore) for complete chloroplast genome assembly
CRISPR-Cas9 genome editing adapted for algal systems
Single-cell genomics to study variation at the cellular level
Targeted RNA-seq approaches for comprehensive chloroplast transcriptome analysis
Innovative protein characterization methods:
Cryo-electron microscopy for membrane protein structure determination
Native mass spectrometry for studying intact protein complexes
Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics
Cross-linking mass spectrometry to map protein interaction networks
In-cell NMR to study proteins in their native environment
Functional genomics tools:
RNA interference and antisense approaches adapted for algal systems
Transcriptome-wide association studies linking genetic variation to expression patterns
High-throughput protein localization using fluorescent protein fusions
Metabolomics integration to connect protein function to metabolic outcomes
Computational advances:
Machine learning approaches for function prediction
Molecular dynamics simulations to understand protein behavior
Network analysis tools to place proteins in biological context
Integrative multi-omics data analysis platforms
Systems biology integration:
These emerging techniques are transforming our ability to study chloroplast-encoded proteins in red algae, moving beyond traditional approaches to provide deeper insights into protein function and evolutionary significance.
Genetic variation data from wild populations of Gracilaria tenuistipitata provides valuable insights that can inform biotechnological applications of algal proteins:
Optimizing source material selection:
Population genetic studies have identified distinct haplotypes (T1-T5) with specific mutation patterns
Genetic diversity analyses reveal population clusters with different characteristics
Selecting source material from populations with desired genetic traits can optimize protein properties
Singapore populations show low genetic diversity, potentially providing more consistent expression results
Protein engineering informed by natural variation:
Natural mutations between populations (e.g., guanidine to adenine at position 190) identify tolerant sites for protein engineering
Comparison of haplotypes reveals correlation between sequence variation and environmental adaptation
Structure-function relationships can be inferred from naturally occurring variants
Directed evolution approaches can be guided by naturally tolerated substitutions
Expression system optimization:
Codon usage patterns from different populations inform optimization for heterologous expression
Post-translational modification patterns across variants guide expression system selection
Natural genetic variation data helps predict protein stability and solubility characteristics
Application-specific variant selection:
Different geographical isolates may possess proteins with varying properties suited to specific applications
Temperature adaptation markers correlate with protein thermostability
Salinity tolerance mechanisms may include modifications to membrane proteins
Stress-resistant populations may express proteins with enhanced stability
Biodiversity conservation considerations:
Understanding genetic diversity informs sustainable harvesting strategies
Identification of unique populations prioritizes conservation efforts
Documentation of genetic resources supports access and benefit-sharing frameworks
By leveraging natural genetic diversity data, biotechnologists can make informed decisions about source material, expression strategies, and protein engineering approaches, potentially improving success rates and developing novel applications.
Scaling up recombinant protein production from algal sources like Gracilaria tenuistipitata presents unique challenges that require specialized solutions:
Genetic material sourcing challenges:
Expression system optimization:
Cultivation and induction challenges:
Temperature sensitivity affects protein folding and solubility
IPTG concentration optimization is crucial for maximizing yield
Scale-up from laboratory to production volumes introduces new variables
Solution: Implement Design of Experiments (DoE) approach to systematically optimize multiple parameters
Extraction and purification scale-up:
Quality control considerations:
Protein heterogeneity increases with scale
Post-translational modifications may vary between expression systems
Functional assays must be adapted for high-throughput analysis
Solution: Implement Process Analytical Technology (PAT) for real-time quality monitoring
Regulatory and compliance factors:
Documentation requirements increase for large-scale production
Consistency and reproducibility must be demonstrated
Solution: Establish robust Standard Operating Procedures (SOPs) and quality management systems
Addressing these challenges requires an integrated approach combining molecular biology, bioprocess engineering, and quality systems to successfully scale recombinant protein production from algal sources.