Recombinant Gracilaria tenuistipitata var. liui Uncharacterized protein ycf92 (ycf92)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant ycf92 Protein

The recombinant Gracilaria tenuistipitata var. liui uncharacterized protein ycf92 (UniProt ID: Q6B8Q5) is a full-length protein (1–245 amino acids) derived from the red alga Gracilaria tenuistipitata var. liui. Its recombinant form is produced in E. coli or mammalian cells for research purposes, with commercial availability in lyophilized or glycerol-based formats . Despite its classification as "uncharacterized," proteomic studies suggest potential roles in cellular interactions or stress responses, though definitive functional data remain limited .

Key Properties of ycf92

PropertyDetails
Sequence Length245 amino acids (full-length)
Molecular WeightCalculated based on AA sequence (~27 kDa, exact value not reported)
Expression HostE. coli (His-tagged) or mammalian cells (untagged)
Purity>85% (SDS-PAGE) to >90% (E. coli-derived)
TagN-terminal His-tag (E. coli production)
Storage BufferTris-based (50% glycerol) or Tris/PBS-based (6% trehalose, pH 8.0)

Amino Acid Sequence:
MNLSQSFLLNRYIQSPRTWLHRLNSNNKIYFLFFYLSIFPYTDVKYMTYSIIFYTILFLY LKHIDKNYKIFILRIVYKVCIFTLAISCLSKLLLSVNIFRLKYISDFFLNLMSICTRNIL YIRSVLILTHYFCTVHITFMTTTYEDIIFAFIPLFTQYQNNIIKKVAFISIFALQAIENT LIKIYSILITIKMKQFTKVFKFQYYIYIYLILKFIQDIYNDIYRISTVFYVRELNHKMSY FTYIY

Secondary Structure Prediction

Proteomic studies on Gracilaria spp. using LC-HRMS identified peptide sequences (e.g., TKKILDK, TVKSLLTK) with β-sheet and α-helix conformations, suggesting hydrophilic interactions and potential roles in protein-binding or antimicrobial activity . While ycf92’s exact structural role remains unclear, its sequence alignment with Rhodophyta proteins hints at conserved functional domains .

Potential Functions

  • Protein Interactions: β-sheet structures may facilitate hydrogen bonding with receptors, a feature often linked to antimicrobial peptides or signaling molecules .

  • Stress Response: The high protein content of G. tenuistipitata var. liui (16.55% dry weight) and its use in biostimulants suggest ycf92 may contribute to cellular resilience, though direct evidence is lacking .

Experimental Use

ApplicationDetails
ELISA KitsUsed as an antigen in immunoassays to study protein-specific interactions .
Purification StudiesRecombinant ycf92 serves as a model for optimizing algal protein production .
Structural BiologyHis-tagged versions enable crystallization or NMR studies .

Handling Recommendations:

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

Research Gaps and Future Directions

  1. Functional Elucidation: No studies directly link ycf92 to specific biochemical pathways or phenotypes.

  2. Comparative Analysis: Limited data on ycf92’s homology with proteins in other algae or model organisms.

  3. Field Applications: While G. tenuistipitata extracts show biostimulant potential, ycf92’s role in these effects remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
ycf92; Grc000149; Uncharacterized protein ycf92
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Gracilaria tenuistipitata var. liui (Red alga)
Target Names
ycf92
Target Protein Sequence
MNLSQSFLLNRYIQSPRTWLHRLNSNNKIYFLFFYLSIFPYTDVKYMTYSIIFYTILFLY LKHIDKNYKIFILRIVYKVCIFTLAISCLSKLLLSVNIFRLKYISDFFLNLMSICTRNIL YIRSVLILTHYFCTVHITFMTTTYEDIIFAFIPLFTQYQNNIIKKVAFISIFALQAIENT LIKIYSILITIKMKQFTKVFKFQYYIYIYLILKFIQDIYNDIYRISTVFYVRELNHKMSY FTYIY
Uniprot No.

Target Background

Protein Families
Ycf92 family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Gracilaria tenuistipitata var. liui and what makes it significant for molecular studies?

Gracilaria tenuistipitata var. liui is a commercially important red algal species belonging to the Rhodophyta division. It has gradually become a model species for cultivation due to its rapid growth and high agar yield . The species was first formally described by Zhang & Xia in 1988, with the holotype collected from Haikou, Hainan Island, Guangdong Province, China . Its significance for molecular studies stems from its well-characterized genome and the presence of various uncharacterized proteins including those in the ycf family, which provides opportunities for novel protein discovery and characterization. The species exhibits genetic variation across different geographical locations, making it valuable for studying genetic diversity and adaptation mechanisms .

How is genetic variation in Gracilaria tenuistipitata typically analyzed?

Genetic variation in Gracilaria tenuistipitata is typically analyzed using both nuclear and mitochondrial molecular markers. Researchers commonly employ two primary approaches:

  • Mitochondrial cox1 gene analysis: This method has proven valuable for studying intraspecific relationships and genetic variation in Gracilaria species. The cox1 gene is considered highly variable and suitable for species identification .

  • Microsatellite (SSR) marker analysis: Simple Sequence Repeat markers derived from the chloroplast genome are used to detect genetic polymorphism. In studies of G. tenuistipitata, primer pairs such as GT1-GT8 have been utilized, though most show monomorphic results with the exception of markers like GT5, which can differentiate between specimens from different geographical locations .

These analyses typically involve DNA extraction, PCR amplification with specific primers, sequencing, and subsequent phylogenetic analysis using methods such as UPGMA (Unweighted Pair Group Method with Arithmetic Mean) and TCS (Templeton-Crandall-Sing) analysis for haplotype network construction .

What are the basic approaches for cloning genes from Gracilaria tenuistipitata var. liui?

The basic approaches for cloning genes from Gracilaria tenuistipitata var. liui involve the following methodological steps:

  • Spore preparation and DNA extraction:

    • Purify spore suspension to appropriate concentration (e.g., 10^9 spores/mL)

    • Crush spores using a bead grinder with acid-washed glass beads

    • Extract genomic DNA using a suitable extraction kit

    • Quantify DNA concentration and store at -20°C

  • Gene sequence identification and primer design:

    • Search target gene sequences from databases like NCBI

    • Design specific forward and reverse primers with appropriate restriction sites

    • Ensure primers are optimized for the target sequence

  • PCR amplification and cloning:

    • Set up PCR reaction systems with high-fidelity DNA polymerase

    • Amplify target genes using optimized thermal cycling conditions

    • Separate PCR products on agarose gel and extract with appropriate kits

    • Clone purified PCR products into suitable vectors (e.g., pMD19-T-Vector)

  • Transformation and verification:

    • Transform recombinant vectors into competent cells (e.g., E. coli TOP10)

    • Culture on selective media (e.g., LB plates with appropriate antibiotics)

    • Identify recombinants by PCR and confirm by sequencing

This basic workflow can be adapted for cloning various genes from G. tenuistipitata var. liui, including uncharacterized proteins such as those in the ycf family.

What are the optimal conditions for recombinant expression of algal proteins like ycf92 in bacterial systems?

The optimal conditions for recombinant expression of algal proteins from Gracilaria tenuistipitata in bacterial systems require careful optimization of several parameters:

  • Expression vector selection:

    • pET series vectors (such as pET-28a) are commonly used for high-level expression

    • Vectors providing appropriate tags (His-tag, GST-tag) facilitate purification

    • Consider codon optimization when expressing algal proteins in bacterial hosts

  • Host strain selection:

    • E. coli BL21 Star (DE3) is frequently used for recombinant protein expression

    • Consider strains with enhanced capabilities for disulfide bond formation or rare codon usage when needed

  • Induction optimization:

    • Temperature: Lower temperatures (20°C rather than 37°C) often improve soluble protein yield

    • IPTG concentration: Test various concentrations to determine optimal induction level

    • Induction duration: Extended periods (up to 20 hours) at lower temperatures may improve yields

  • Protein extraction and analysis:

    • Ultrasonic disruption (typically 250W, with appropriate pulse cycles) effectively lyses bacterial cells

    • Separate soluble and insoluble fractions by centrifugation to determine protein solubility

    • Analyze expression using SDS-PAGE and Western blotting

For algal proteins that may be challenging to express in soluble form, additional strategies may include fusion with solubility-enhancing tags, co-expression with chaperones, or use of specifically engineered E. coli strains designed to enhance protein folding.

How can bioinformatic analysis enhance the characterization of uncharacterized proteins like ycf92?

Bioinformatic analysis provides crucial insights into the properties and potential functions of uncharacterized proteins like ycf92 from Gracilaria tenuistipitata var. liui. A comprehensive bioinformatic workflow includes:

  • Primary sequence analysis:

    • Molecular weight and isoelectric point prediction using tools like Compute pI/Mw

    • Identification of conserved domains using PFAM, CDD, or InterProScan

    • Multiple sequence alignment with homologous proteins to identify conserved residues

  • Structural feature prediction:

    • Signal peptide prediction using SignalP-5 to determine secretory potential

    • Transmembrane domain prediction using TMHMM Server v.2.0 to assess membrane association

    • Secondary structure prediction using tools like PSIPRED or JPred

  • Post-translational modification prediction:

    • Phosphorylation site prediction through DTU Health Tech resources

    • Glycosylation site prediction to identify potential modification sites

    • Other PTM predictions based on sequence motifs

  • Subcellular localization prediction:

    • Tools like CELLO v.2.5 can predict the likely cellular compartment

    • Comparison of predictions from multiple tools improves confidence

    • Integration with experimental data for validation

  • Functional annotation through:

    • Gene Ontology term assignment

    • Protein-protein interaction network prediction

    • Comparative analysis with characterized proteins from related species

This multi-layered approach provides a foundation for experimental design and can guide targeted studies to validate predicted features and functions of uncharacterized proteins.

What are the methodological challenges in characterizing membrane-associated proteins from algal sources?

Characterizing membrane-associated proteins from algal sources like Gracilaria tenuistipitata presents several methodological challenges that require specialized approaches:

  • Extraction and solubilization challenges:

    • Algal cell walls require more aggressive disruption methods

    • Membrane proteins often require detergents for solubilization

    • Different detergents must be screened for optimal extraction without denaturation

    • Two-phase partitioning systems may be necessary to separate membrane fractions

  • Expression system limitations:

    • Bacterial expression systems may not properly fold algal membrane proteins

    • Codon usage differences between algae and bacteria may reduce expression efficiency

    • Post-translational modifications common in algae may be absent in bacterial systems

    • Alternative expression systems (yeast, insect cells) may be needed for functional expression

  • Structural analysis complications:

    • Membrane proteins are difficult to crystallize for X-ray crystallography

    • Detergents needed for solubilization may interfere with structural studies

    • Sample preparation for cryo-EM requires specialized approaches

    • NMR studies require isotope labeling, which may be difficult in non-native expression systems

  • Functional characterization difficulties:

    • Transport assays require reconstitution in artificial membrane systems

    • Interaction partners from the original algal system may be unknown

    • Functional redundancy may mask phenotypes in knockout/knockdown studies

    • Species-specific interaction networks may not be well characterized

Addressing these challenges requires integration of multiple approaches, including advanced microscopy techniques, proteoliposome reconstitution, and specialized mass spectrometry methods adapted for membrane proteins.

How does genetic variation in Gracilaria tenuistipitata impact protein expression profiles?

Genetic variation in Gracilaria tenuistipitata has significant implications for protein expression profiles, including uncharacterized proteins like those in the ycf family:

  • Population-specific expression patterns:

    • Studies have identified distinct genetic populations of G. tenuistipitata using both mitochondrial cox1 gene and microsatellite markers

    • Specimens from Singapore were grouped into two different genotypes using SSR markers, suggesting potential differences in gene expression profiles

    • Geographical variation may correlate with differential adaptation mechanisms reflected in protein expression

  • Haplotype-specific protein variants:

    • Five mitochondrial haplotypes (T1-T5) have been identified in G. tenuistipitata populations from different regions

    • Specific mutation changes between haplotypes (e.g., guanidine to adenine at position 190, cytosine to thymine at position 225) may alter protein-coding sequences

    • These genetic differences can potentially result in functional variations in expressed proteins

  • Implications for recombinant protein expression:

    • Selecting source material from specific genetic populations may influence protein properties

    • Documented mutations between populations could affect protein structure and function

    • Research populations with low genetic diversity (like those in Singapore) may provide more consistent expression results

Understanding these genetic diversity patterns provides important context for researchers working with recombinant proteins from this species, as source material selection can significantly impact experimental outcomes.

What techniques are most effective for analyzing genetic variation in chloroplast-encoded proteins like ycf92?

The most effective techniques for analyzing genetic variation in chloroplast-encoded proteins like ycf92 from Gracilaria tenuistipitata combine genomic, transcriptomic, and proteomic approaches:

  • Genomic DNA analysis:

    • Chloroplast genome sequencing provides the foundation for identifying variations

    • PCR-RFLP (Restriction Fragment Length Polymorphism) can detect major structural variations

    • Targeted sequencing of chloroplast genes using specific primers (as demonstrated with microsatellite markers in G. tenuistipitata)

    • Next-generation sequencing approaches for entire chloroplast genome comparison

  • RNA-based methods:

    • RT-PCR to assess expression levels across different populations

    • RNA-Seq to comprehensively analyze transcriptome-wide expression patterns

    • Differential expression analysis between populations with different genetic backgrounds

  • Protein-level analysis:

    • 2D gel electrophoresis to compare protein isoforms across populations

    • Mass spectrometry to identify post-translational modifications

    • Protein structure analysis to determine functional implications of amino acid substitutions

  • Population genetics approaches:

    • Haplotype network analysis (as demonstrated with cox1 gene in G. tenuistipitata)

    • UPGMA dendrogram construction to visualize relationships between populations

    • Analysis of similarity coefficients to quantify genetic relationships

The combination of these techniques provides a comprehensive view of genetic variation, from the DNA sequence level to functional protein differences, enabling researchers to understand the evolutionary significance and functional implications of variations in chloroplast-encoded proteins.

What are the optimal protocols for extracting high-quality DNA from Gracilaria tenuistipitata for gene cloning purposes?

Extracting high-quality DNA from Gracilaria tenuistipitata for gene cloning requires specialized protocols that address the challenges presented by algal tissue:

  • Sample preparation:

    • Fresh tissue should be cleaned thoroughly to remove epiphytes and contaminants

    • Flash freezing in liquid nitrogen followed by lyophilization preserves DNA integrity

    • Mechanical disruption using acid-washed glass beads in a bead grinder is effective for breaking down tough cell walls

    • Multiple grinding cycles (e.g., 1 minute grinding followed by 5 minutes cooling on ice, repeated 6 times) ensures thorough disruption while preventing heat denaturation

  • Extraction methodology:

    • Commercial fungal/plant genomic DNA extraction kits provide reliable results

    • CTAB (cetyltrimethylammonium bromide) method with modifications for high polysaccharide content

    • Addition of polyvinylpyrrolidone (PVP) to remove phenolic compounds

    • Multiple phenol-chloroform extraction steps may be necessary to achieve high purity

  • DNA purification:

    • RNase treatment to remove RNA contamination

    • Ethanol precipitation with sodium acetate for concentration and further purification

    • Size-selection may be necessary for downstream applications like library preparation

  • Quality assessment:

    • Spectrophotometric analysis (260/280 and 260/230 ratios) to assess purity

    • Gel electrophoresis to evaluate integrity and fragment size

    • PCR amplification of control genes to confirm suitability for molecular applications

Following extraction, storage at -20°C maintains DNA stability for downstream cloning applications . Researchers should adjust protocols based on the specific characteristics of their samples, particularly when working with specimens from different geographical locations that may have varying biochemical compositions.

How can researchers troubleshoot expression problems when working with recombinant algal proteins?

Troubleshooting expression problems with recombinant algal proteins like ycf92 from Gracilaria tenuistipitata requires a systematic approach to identify and resolve specific issues:

  • Low expression yield troubleshooting:

    • Optimize codon usage for the expression host (E. coli)

    • Test multiple expression vectors with different promoter strengths

    • Evaluate different E. coli strains specialized for protein expression

    • Adjust induction conditions (IPTG concentration, temperature, duration)

    • Check for toxicity by monitoring growth curves after induction

  • Protein solubility issues:

    • Reduce induction temperature (20°C or lower) to slow protein synthesis and improve folding

    • Co-express with molecular chaperones to assist protein folding

    • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Add compatible solutes or mild detergents to the growth medium

    • Consider cell-free expression systems for highly toxic or insoluble proteins

  • Protein degradation problems:

    • Add protease inhibitors during extraction and purification

    • Use E. coli strains deficient in specific proteases (e.g., BL21)

    • Optimize extraction buffer composition (pH, salt concentration)

    • Perform extraction at lower temperatures (4°C)

    • Minimize handling time during purification

  • Purification challenges:

    • Optimize lysis conditions (sonication parameters: 250W, 3s pulses with 5s intervals)

    • Test different buffer systems for improved protein stability

    • Use affinity chromatography with appropriate tags

    • Consider on-column refolding for proteins in inclusion bodies

    • Implement size exclusion chromatography as a final polishing step

  • Systematic analysis approach:

    • Analyze each step of the expression process separately

    • Use SDS-PAGE and Western blotting to track protein throughout the process

    • Compare multiple expression conditions in parallel small-scale experiments

    • Document all parameters to identify patterns in successful expressions

This methodical approach allows researchers to identify specific bottlenecks in the expression process and implement targeted solutions.

What are the key considerations for designing primers for amplifying chloroplast genes from Gracilaria tenuistipitata?

Designing effective primers for amplifying chloroplast genes from Gracilaria tenuistipitata requires attention to several critical factors:

  • Target sequence analysis:

    • Obtain complete gene sequences from databases like NCBI

    • Analyze GC content and secondary structure of the target region

    • Identify conserved regions by aligning homologous sequences from related species

    • Check for repetitive elements or regions of high variability that may complicate amplification

  • Primer design parameters:

    • Optimal primer length: 18-30 nucleotides

    • GC content: 40-60% for stable annealing

    • Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs

    • Add restriction enzyme sites to facilitate cloning (with additional bases at 5' end for efficient digestion)

    • Avoid secondary structures, primer-dimers, and self-complementary sequences

  • Algae-specific considerations:

    • Account for codon bias in algal genomes

    • Be aware of AT-rich regions in chloroplast genes that may require special consideration

    • Check for organelle-specific nuances in genetic code

    • Consider potential heteroplasmy in chloroplast genomes

  • Experimental validation strategy:

    • Design multiple primer pairs for important targets

    • Include positive controls using previously amplified genes

    • Optimize PCR conditions (annealing temperature, MgCl₂ concentration, cycle number)

    • Consider touchdown PCR for difficult templates

  • Special applications:

    • For microsatellite analysis, design primers flanking SSR regions as demonstrated with GT1-GT8 primers

    • For phylogenetic studies, prioritize regions shown to have appropriate levels of variation (e.g., cox1)

    • For expression studies, ensure primers span exon-exon junctions when working with cDNA

Following these guidelines increases the likelihood of successful amplification of chloroplast genes from G. tenuistipitata, providing high-quality template DNA for downstream applications like cloning and expression.

How does ycf92 from Gracilaria tenuistipitata var. liui compare structurally and functionally with homologous proteins from other algal species?

Comparative analysis of ycf92 from Gracilaria tenuistipitata var. liui with homologous proteins from other algal species reveals insights into its potential structure and function:

  • Sequence conservation patterns:

    • Alignment of ycf family proteins across red algal species reveals conserved motifs

    • Conservation analysis identifies functionally important residues maintained through evolutionary pressure

    • Comparison with homologs from diverse algal lineages helps distinguish red algae-specific features

  • Structural comparison approaches:

    • Secondary structure prediction tools identify common structural elements

    • Transmembrane domain analysis reveals similar membrane topology across related species

    • Protein modeling using homology-based approaches provides three-dimensional structural insights

    • Signal peptide comparison helps determine subcellular localization consistency

  • Functional prediction through comparative genomics:

    • Synteny analysis examines gene neighborhood conservation across species

    • Co-expression pattern comparison across diverse algal transcriptomes

    • Association with specific cellular pathways based on homologs with known functions

    • Identification of conserved interaction partners through interactome analysis

  • Evolutionary context:

    • Phylogenetic analysis places the protein in evolutionary context

    • Population genetic studies reveal selective pressures on the gene

    • The genetic diversity observed in G. tenuistipitata populations provides insights into functional constraints on the protein

This comparative approach provides a foundation for hypothesis generation regarding protein function and guides experimental design for functional characterization studies.

What bioinformatic pipelines are recommended for predicting the function of uncharacterized proteins from algal genomes?

For predicting the function of uncharacterized proteins like ycf92 from algal genomes, the following bioinformatic pipeline is recommended:

  • Initial sequence analysis:

    • Compute basic protein parameters (molecular weight, isoelectric point) using tools like ExPASy Compute pI/Mw

    • Perform BLAST searches against multiple databases (nr, SwissProt, model organism databases)

    • Execute HMM-based searches against specialized databases (PFAM, TIGRFAM)

    • Identify conserved domains using InterProScan and CDD

  • Structural feature prediction:

    • Predict signal peptides using SignalP-5.0 to determine secretory potential

    • Identify transmembrane domains using TMHMM Server v.2.0

    • Predict secondary structure using PSIPRED or JPred

    • Generate tertiary structure models using AlphaFold or RoseTTAFold

    • Validate models using MolProbity or PROCHECK

  • Post-translational modification prediction:

    • Predict phosphorylation sites using NetPhos or DTU Health Tech tools

    • Identify glycosylation sites using NetNGlyc and NetOGlyc

    • Analyze other potential modifications based on sequence motifs

  • Advanced functional prediction:

    • Subcellular localization prediction using CELLO v.2.5

    • Gene Ontology term assignment through tools like PANNZER2 or eggNOG-mapper

    • Pathway association using KEGG Orthology tools

    • Protein-protein interaction prediction via STRING or InterPreTS

  • Integration and validation:

    • Combine multiple prediction methods using consensus approaches

    • Cross-reference predictions with experimental data from related species

    • Prioritize function predictions based on confidence scores

    • Design targeted experiments to test specific functional hypotheses

This comprehensive pipeline leverages multiple complementary approaches to overcome limitations of individual methods and provides researchers with testable hypotheses about protein function.

What are emerging techniques for studying chloroplast-encoded proteins in red algae?

Emerging techniques for studying chloroplast-encoded proteins in red algae like Gracilaria tenuistipitata are advancing our understanding of these important but often uncharacterized proteins:

  • Advanced genomic approaches:

    • Long-read sequencing technologies (PacBio, Oxford Nanopore) for complete chloroplast genome assembly

    • CRISPR-Cas9 genome editing adapted for algal systems

    • Single-cell genomics to study variation at the cellular level

    • Targeted RNA-seq approaches for comprehensive chloroplast transcriptome analysis

  • Innovative protein characterization methods:

    • Cryo-electron microscopy for membrane protein structure determination

    • Native mass spectrometry for studying intact protein complexes

    • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics

    • Cross-linking mass spectrometry to map protein interaction networks

    • In-cell NMR to study proteins in their native environment

  • Functional genomics tools:

    • RNA interference and antisense approaches adapted for algal systems

    • Transcriptome-wide association studies linking genetic variation to expression patterns

    • High-throughput protein localization using fluorescent protein fusions

    • Metabolomics integration to connect protein function to metabolic outcomes

  • Computational advances:

    • Machine learning approaches for function prediction

    • Molecular dynamics simulations to understand protein behavior

    • Network analysis tools to place proteins in biological context

    • Integrative multi-omics data analysis platforms

  • Systems biology integration:

    • Multi-level omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Comparison across multiple genetic variants from different populations

    • Environmental response profiling under various conditions

These emerging techniques are transforming our ability to study chloroplast-encoded proteins in red algae, moving beyond traditional approaches to provide deeper insights into protein function and evolutionary significance.

How might genetic variation data from wild populations inform biotechnological applications of algal proteins?

Genetic variation data from wild populations of Gracilaria tenuistipitata provides valuable insights that can inform biotechnological applications of algal proteins:

  • Optimizing source material selection:

    • Population genetic studies have identified distinct haplotypes (T1-T5) with specific mutation patterns

    • Genetic diversity analyses reveal population clusters with different characteristics

    • Selecting source material from populations with desired genetic traits can optimize protein properties

    • Singapore populations show low genetic diversity, potentially providing more consistent expression results

  • Protein engineering informed by natural variation:

    • Natural mutations between populations (e.g., guanidine to adenine at position 190) identify tolerant sites for protein engineering

    • Comparison of haplotypes reveals correlation between sequence variation and environmental adaptation

    • Structure-function relationships can be inferred from naturally occurring variants

    • Directed evolution approaches can be guided by naturally tolerated substitutions

  • Expression system optimization:

    • Codon usage patterns from different populations inform optimization for heterologous expression

    • Post-translational modification patterns across variants guide expression system selection

    • Natural genetic variation data helps predict protein stability and solubility characteristics

  • Application-specific variant selection:

    • Different geographical isolates may possess proteins with varying properties suited to specific applications

    • Temperature adaptation markers correlate with protein thermostability

    • Salinity tolerance mechanisms may include modifications to membrane proteins

    • Stress-resistant populations may express proteins with enhanced stability

  • Biodiversity conservation considerations:

    • Understanding genetic diversity informs sustainable harvesting strategies

    • Identification of unique populations prioritizes conservation efforts

    • Documentation of genetic resources supports access and benefit-sharing frameworks

By leveraging natural genetic diversity data, biotechnologists can make informed decisions about source material, expression strategies, and protein engineering approaches, potentially improving success rates and developing novel applications.

What are the challenges and solutions for scaling up recombinant protein production from algal sources?

Scaling up recombinant protein production from algal sources like Gracilaria tenuistipitata presents unique challenges that require specialized solutions:

  • Genetic material sourcing challenges:

    • Population genetic diversity affects protein consistency

    • Geographic variations influence gene sequence and expression optimization

    • Low genetic diversity sources (like Singapore populations) may provide more consistent results

    • Solution: Establish characterized genetic stocks with documented molecular profiles

  • Expression system optimization:

    • Bacterial expression systems may not properly process algal proteins

    • Codon optimization is essential for efficient heterologous expression

    • Membrane proteins require specialized expression strategies

    • Solution: Develop specialized expression vectors with algal-optimized features and test multiple host systems

  • Cultivation and induction challenges:

    • Temperature sensitivity affects protein folding and solubility

    • IPTG concentration optimization is crucial for maximizing yield

    • Scale-up from laboratory to production volumes introduces new variables

    • Solution: Implement Design of Experiments (DoE) approach to systematically optimize multiple parameters

  • Extraction and purification scale-up:

    • Cell disruption methods differ between laboratory and industrial scales

    • Ultrasonic disruption is effective at small scale but challenging to scale up

    • Membrane proteins require detergent optimization

    • Solution: Develop continuous processing methods with in-line monitoring

  • Quality control considerations:

    • Protein heterogeneity increases with scale

    • Post-translational modifications may vary between expression systems

    • Functional assays must be adapted for high-throughput analysis

    • Solution: Implement Process Analytical Technology (PAT) for real-time quality monitoring

  • Regulatory and compliance factors:

    • Documentation requirements increase for large-scale production

    • Consistency and reproducibility must be demonstrated

    • Solution: Establish robust Standard Operating Procedures (SOPs) and quality management systems

Addressing these challenges requires an integrated approach combining molecular biology, bioprocess engineering, and quality systems to successfully scale recombinant protein production from algal sources.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.