Recombinant Granulibacter bethesdensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Granulibacter bethesdensis

ATP synthase subunit a forms part of the F0 sector of the ATP synthase complex, enabling proton translocation across the membrane to drive ATP synthesis . In G. bethesdensis, this enzyme is essential for:

  • Energy metabolism: Sustaining bacterial survival under low-oxygen conditions encountered in CGD phagocytes .

  • Pathogenicity: Contributing to persistence in host macrophages by maintaining metabolic activity during intracellular survival .

Studies show that G. bethesdensis resists NADPH oxidase-independent killing mechanisms in CGD patients, relying on ATP synthase for long-term survival in monocytes and macrophages .

4.1. Immune Evasion Mechanisms

  • CGD pathogenesis: Recombinant atpB has been used to study how G. bethesdensis survives in CGD phagocytes. The bacterium persists in monocytes by resisting reactive oxygen species (ROS)-independent killing, a trait linked to ATP synthase activity .

  • Cytokine modulation: Infection models show that G. bethesdensis triggers weaker pro-inflammatory cytokine responses compared to E. coli, potentially due to structural differences in endotoxin or ATP synthase interactions .

4.2. Antimicrobial Resistance Studies

  • Drug target exploration: Genomic analyses reveal that G. bethesdensis ATP synthase shares homology with other multidrug-resistant pathogens, highlighting its potential as a therapeutic target .

Challenges and Future Directions

  • Structural resolution: No crystallographic data for atpB exists; further studies are needed to map proton channel dynamics.

  • Therapeutic potential: Targeting ATP synthase could disrupt bacterial energy metabolism, but G. bethesdensis’s environmental reservoir and transmission routes remain poorly understood .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format when placing your order, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your convenience.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms, on the other hand, can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; GbCGDNIH1_1867; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Target Names
atpB
Target Protein Sequence
MAAEPTIDALGQFRLHHGLGPIGGLVNFTQSNEIMVLGTAIVLGIIALGMRQRAVVPGRL QSLVEISYNFIMGLCIEQIGHEGKKFFPFIFTLFFFVLMGNLLGLFPYFFTYTSHVAVTG GLAVLVIVLVTAVALRYHGLHFFSYFFPPGAPKALAPIIVPIEIISYLSRPVSLSIRLFA NMVAGHVMFEVFATFMFLLIGALGTFGYFAALLPMTLNVTLVGFELLVAFLQAYVFAILT CIYLHDAVHLH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in facilitating the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Granulibacter bethesdensis ATP synthase subunit a (atpB)?

Granulibacter bethesdensis is a pathogen associated with chronic granulomatous disease, an immunodeficiency caused by reduced phagocyte NADPH oxidase function . The ATP synthase subunit a (atpB) is a critical component of the ATP synthase complex, which is responsible for ATP production through oxidative phosphorylation. While traditionally considered to function exclusively in energy metabolism within the cell, ATP synthase components have been found ectopically expressed on the cellular surface in certain conditions, as demonstrated with ATP synthase beta subunit in lung cancer cells . The atpB protein is particularly interesting in G. bethesdensis due to its potential role in pathogenicity and immune evasion mechanisms.

How does G. bethesdensis atpB differ from ATP synthase components in other bacteria?

G. bethesdensis possesses unique structural features that distinguish it from typical Enterobacteriaceae, particularly in its cellular membrane components . While the search results don't provide specific information about atpB differences, G. bethesdensis demonstrates unusual lipopolysaccharide (LPS) structure with glycero-d-talo-oct-2-ulosonic acid (Ko) as the first constituent of the core region, contributing to acid resistance and reduced inflammatory response . These distinct structural properties likely extend to its membrane proteins, including potential modifications in ATP synthase components that may contribute to its pathogenicity and immune evasion capabilities.

What is the significance of studying recombinant G. bethesdensis atpB?

Studying recombinant G. bethesdensis atpB has significant implications for understanding bacterial pathogenesis and developing targeted therapies. Research on ATP synthase subunits in other contexts has revealed their potential as diagnostic and therapeutic targets. For instance, ATP synthase beta subunit (ATPB) has been identified as a tumor-associated antigen in non-small cell lung cancer (NSCLC), with abnormal expression on the cell surface . By extension, investigating recombinant G. bethesdensis atpB could provide insights into its role in bacterial virulence, potential surface expression, and its interaction with the host immune system, especially in the context of chronic granulomatous disease.

What are the structural characteristics of G. bethesdensis atpB that might contribute to pathogenesis?

While the specific structural characteristics of G. bethesdensis atpB are not directly addressed in the search results, we can infer potential features based on related research. G. bethesdensis demonstrates unique structural properties in its membrane components, including a hypostimulatory lipopolysaccharide that contributes to immune evasion . If atpB is expressed on the cell surface, similar to what has been observed with ATP synthase beta subunit in lung cancer cells , it may contribute to pathogenesis through:

  • Potential interaction with host immune components

  • Contribution to acid resistance mechanisms

  • Involvement in immune evasion strategies

  • Possible role in cellular adhesion or invasion

Research methodologies to investigate these characteristics would include protein crystallography, molecular modeling, and functional assays to identify specific domains involved in pathogenesis.

How does ectopic expression of atpB on the bacterial surface affect host immune response?

Ectopic expression of ATP synthase components on cellular surfaces has significant immunological implications. In lung cancer cells, ATP synthase beta subunit (ATPB) abnormally expressed on the cell surface has been identified as a tumor-associated antigen recognized by specific monoclonal antibodies . By analogy, if G. bethesdensis expresses atpB on its surface, this could:

  • Present a target for host antibody recognition

  • Potentially modulate host immune responses

  • Contribute to bacterial persistence in chronic granulomatous disease patients

Experimental approaches to investigate this question would include flow cytometry to confirm surface expression, production of specific antibodies against recombinant atpB, and in vitro infection models to assess host immune cell interactions with wild-type versus atpB-knockout bacterial strains.

What is the relationship between G. bethesdensis atpB and the bacteria's hypostimulatory nature?

G. bethesdensis is notably hypostimulatory compared to other bacteria like E. coli, requiring 10-100 times more CFU/mL to induce comparable cytokine production in human blood . While the search results attribute this property primarily to its unusual lipopolysaccharide structure, membrane proteins including atpB may potentially contribute to this hypostimulatory effect through:

Research to elucidate this relationship would require comparative studies between wild-type G. bethesdensis and atpB-modified strains, examining their stimulatory capacity in various immune cell models.

What are the optimal conditions for expressing recombinant G. bethesdensis atpB?

Based on general principles for recombinant protein expression and the information available about ATP synthase subunits, the optimal conditions for expressing recombinant G. bethesdensis atpB would likely include:

  • Expression System Selection:

    • E. coli BL21(DE3) for high-yield cytoplasmic expression

    • Alternative hosts such as Pichia pastoris if proper folding is challenging in E. coli

  • Vector Design:

    • Inclusion of appropriate purification tags (His6, GST, or MBP)

    • Codon optimization for the expression host

    • Inducible promoter systems (T7 or tac)

  • Culture Conditions:

    • Lower induction temperatures (16-25°C) to enhance proper folding

    • Supplementation with membrane-mimicking agents for membrane protein stability

    • Controlled induction with reduced IPTG concentrations (0.1-0.5 mM)

  • Extraction Methods:

    • Mild detergents for membrane protein solubilization

    • Inclusion of stabilizing agents in buffers

The approach would be similar to methods used for isolating membrane proteins from A549 cells, which successfully preserved the antigenic properties of ATPB .

What purification strategy would yield the highest purity and activity of recombinant atpB?

A multi-step purification strategy would be optimal for recombinant G. bethesdensis atpB:

Purification StepMethodPurposeExpected Outcome
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)Capture His-tagged protein70-80% purity
Intermediate PurificationIon Exchange ChromatographyRemove charged contaminants85-95% purity
PolishingSize Exclusion ChromatographyRemove aggregates and obtain native conformation>95% purity
Quality ControlSDS-PAGE and Western BlotConfirm identity and purityVerification of target protein

Throughout the purification process, it would be essential to:

  • Maintain appropriate detergent concentrations to preserve membrane protein conformation

  • Include stabilizing agents such as glycerol or specific lipids

  • Monitor protein activity using ATP hydrolysis assays

  • Verify proper folding through circular dichroism spectroscopy

This strategy incorporates elements similar to those used in the purification of membrane proteins for antibody production against A549 cell surface proteins .

How can one verify the structural integrity and functionality of purified recombinant atpB?

Verification of structural integrity and functionality of purified recombinant G. bethesdensis atpB would require multiple complementary approaches:

  • Structural Analysis:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to assess stability

  • Functional Assays:

    • ATP hydrolysis activity measurements

    • Proton translocation assays if incorporated into liposomes

    • Binding studies with known interaction partners

  • Immunological Verification:

    • Development of specific antibodies against recombinant atpB

    • Western blot analysis comparing recombinant protein with native protein

    • Epitope mapping to confirm proper conformation

  • Mass Spectrometry:

    • Peptide mass fingerprinting for protein identification

    • Analysis of post-translational modifications

    • Hydrogen-deuterium exchange for structural dynamics

This multi-faceted approach would provide comprehensive validation of the recombinant protein's integrity, similar to the proteomic approaches used to identify ATPB in cancer cell studies .

How should experiments be designed to study potential ectopic expression of atpB on G. bethesdensis cell surface?

To investigate potential ectopic expression of atpB on the G. bethesdensis cell surface, a systematic experimental approach should be employed:

  • Antibody Production and Validation:

    • Generate specific antibodies against recombinant G. bethesdensis atpB

    • Validate antibody specificity through Western blot and ELISA

    • Ensure antibodies recognize native conformation through immunoprecipitation

  • Surface Localization Studies:

    • Flow cytometry analysis of intact bacteria using anti-atpB antibodies

    • Immunofluorescence microscopy with membrane-impermeable fixation protocols

    • Surface biotinylation followed by pull-down and Western blot analysis

  • Comparative Analysis:

    • Compare expression patterns between G. bethesdensis and other bacteria

    • Examine expression under different growth conditions and stress factors

    • Investigate expression in clinical isolates versus laboratory strains

This approach would be similar to the flow cytometric analysis used to demonstrate ATPB localization on A549 cell surfaces , adapted for bacterial cells.

What controls are essential when assessing the immunogenicity of recombinant G. bethesdensis atpB?

When assessing the immunogenicity of recombinant G. bethesdensis atpB, the following controls are essential:

  • Negative Controls:

    • Purification tag alone (His, GST, etc.) to exclude tag-induced responses

    • Unrelated recombinant protein from G. bethesdensis to control for general bacterial protein effects

    • Buffer components without protein to exclude endotoxin contamination effects

  • Positive Controls:

    • Known immunogenic proteins from G. bethesdensis

    • Lipopolysaccharide (LPS) as a strong immune stimulator

    • Commercial TLR agonists for calibration of immune responses

  • Comparative Controls:

    • Equivalent ATP synthase components from non-pathogenic bacteria

    • Native versus denatured atpB to assess conformation-dependent responses

    • Different concentrations of atpB to establish dose-response relationships

  • Cell-Specific Controls:

    • Multiple immune cell types (monocytes, dendritic cells, neutrophils)

    • Cells from healthy donors versus CGD patients

    • Pharmacological inhibitors of specific immune pathways

This comprehensive control strategy would help distinguish specific immunological effects of atpB from non-specific or contamination-related responses, similar to the approach used in evaluating the inhibitory effect of McAb4E7 on A549 cells .

How can one design experiments to determine if atpB contributes to G. bethesdensis pathogenicity?

To determine if atpB contributes to G. bethesdensis pathogenicity, a multi-faceted experimental approach is necessary:

  • Genetic Manipulation:

    • Create atpB knockout or knockdown strains using CRISPR-Cas9 or homologous recombination

    • Develop complementation strains to verify phenotype specificity

    • Generate point mutations in key functional domains of atpB

  • In Vitro Virulence Assays:

    • Assess bacterial survival in human blood and serum from healthy and CGD patients

    • Evaluate bacterial persistence in macrophage and neutrophil infection models

    • Measure cytokine induction compared to wild-type strains

  • Functional Analysis:

    • Examine sensitivity to antimicrobial peptides and oxidative stress

    • Assess bacterial adhesion and invasion capabilities

    • Evaluate metabolic fitness under infection-relevant conditions

  • In Vivo Models (if appropriate):

    • Compare wild-type and atpB-modified strains in CGD mouse models

    • Assess bacterial burden in different organs

    • Measure inflammatory responses and tissue damage

The design would incorporate quantitative measurements similar to those used in the MTT cell proliferation assay that evaluated the inhibitory effect of McAb4E7 on A549 cells , but adapted to assess bacterial virulence.

How should researchers interpret differences in atpB expression between clinical and laboratory G. bethesdensis strains?

Interpreting differences in atpB expression between clinical and laboratory G. bethesdensis strains requires careful consideration of multiple factors:

  • Quantitative Analysis Framework:

    • Normalize expression data to multiple housekeeping genes

    • Use both transcriptomic (RNA) and proteomic approaches for validation

    • Establish statistical significance thresholds appropriate for sample size

  • Contextual Interpretation:

    • Consider adaptation to laboratory conditions versus in vivo selection pressures

    • Evaluate correlations with other virulence factors

    • Assess relationships between expression levels and clinical outcomes

  • Functional Correlation:

    • Determine if expression differences correlate with phenotypic differences

    • Assess impact on measurable virulence properties

    • Evaluate relationship to antimicrobial resistance profiles

  • Evolutionary Perspective:

    • Analyze genomic regions surrounding atpB for selection signatures

    • Compare with closely related non-pathogenic species

    • Consider horizontal gene transfer possibilities

This interpretative framework would be comparable to the analysis used to assess the rate of ectopic ATPB expression in different lung cancer types and adjacent tissues , as shown in Table 1 of the first search result.

What statistical approaches are most appropriate for analyzing antibody responses to recombinant G. bethesdensis atpB?

The statistical analysis of antibody responses to recombinant G. bethesdensis atpB should employ multiple complementary approaches:

  • Descriptive Statistics:

    • Mean, median, range, and standard deviation of antibody titers

    • Graphical representation through box plots and scatter plots

    • Frequency distribution analysis of responders versus non-responders

  • Comparative Analyses:

    • Paired t-tests or Wilcoxon signed-rank tests for matched samples

    • ANOVA or Kruskal-Wallis tests for multiple group comparisons

    • Post-hoc corrections for multiple comparisons (Bonferroni, Tukey)

  • Correlation Analyses:

    • Pearson or Spearman correlation between antibody responses and clinical parameters

    • Multiple regression to identify predictors of strong responses

    • Principal component analysis for patterns in multiparameter responses

  • Advanced Modeling:

    • Time-series analysis for longitudinal antibody responses

    • Bayesian approaches for small sample sizes

    • Machine learning for identifying complex patterns in response data

This statistical framework would provide robust analysis similar to the approach used in analyzing the differential expression of ATPB in various lung cancer subtypes , but adapted for immunological response data.

Statistical TestApplicationAdvantagesLimitations
Student's t-testComparing two groupsSimple, powerful for normal dataAssumes normal distribution
Mann-Whitney UComparing two groupsNo normality assumptionLess power than t-test
ANOVAComparing multiple groupsComprehensive analysisAssumes homogeneity of variance
Chi-squareCategorical outcomesGood for responder analysisRequires adequate sample size
Survival analysisTime-to-event dataHandles censored dataComplex interpretation

How can researchers address experimental contradictions in studies of G. bethesdensis atpB function?

Addressing experimental contradictions in studies of G. bethesdensis atpB function requires a systematic approach:

  • Methodological Reconciliation:

    • Compare experimental protocols in detail to identify critical differences

    • Standardize key reagents, particularly antibodies and recombinant proteins

    • Conduct side-by-side replication of contradictory experiments

    • Develop consensus protocols through collaborative efforts

  • Biological Variability Assessment:

    • Evaluate strain differences in G. bethesdensis isolates

    • Consider host cell or animal model variations

    • Assess impact of growth conditions and experimental microenvironments

    • Examine genetic drift in laboratory strains

  • Technical Resolution Strategies:

    • Employ orthogonal techniques to verify key findings

    • Increase statistical power through larger sample sizes

    • Conduct blinded analysis to reduce experimenter bias

    • Implement more sensitive or specific detection methods

  • Conceptual Integration:

    • Develop models that accommodate seemingly contradictory results

    • Consider context-dependent functions of atpB

    • Evaluate threshold effects and non-linear responses

    • Explore feedback mechanisms and regulatory networks

This approach would help resolve contradictions similar to how researchers might reconcile differences in ATPB localization between different cell types or tissues .

What are the potential diagnostic applications of anti-G. bethesdensis atpB antibodies?

Recombinant G. bethesdensis atpB and corresponding antibodies have several potential diagnostic applications:

  • Clinical Diagnostics:

    • Development of serological assays to detect G. bethesdensis infections in CGD patients

    • Creation of rapid antigen detection tests for patient specimens

    • Immunohistochemical staining of tissue samples to identify bacterial presence

  • Research Applications:

    • Monitoring bacterial burden in experimental infection models

    • Tracking bacterial distribution in tissue culture systems

    • Distinguishing G. bethesdensis from related species in mixed cultures

  • Technology Platforms:

    • ELISA-based detection systems for clinical laboratories

    • Lateral flow immunoassays for point-of-care settings

    • Fluorescent antibody techniques for research applications

    • Antibody microarrays for multiplex pathogen detection

This approach would be comparable to the immunohistochemical analysis used to detect ATPB expression in lung cancer tissues , but adapted for bacterial detection in clinical specimens.

How might understanding G. bethesdensis atpB structure inform therapeutic development for CGD patients?

Understanding the structure of G. bethesdensis atpB could inform therapeutic development for CGD patients through several mechanisms:

  • Antibody-Based Therapeutics:

    • Development of neutralizing antibodies targeting surface-exposed atpB

    • Creation of antibody-drug conjugates for targeted bacterial killing

    • Design of bispecific antibodies linking bacterial recognition with immune effector functions

  • Small Molecule Inhibitors:

    • Identification of atpB functional domains as drug targets

    • Structure-based design of specific inhibitors

    • Development of allosteric modulators of atpB function

  • Vaccine Development:

    • Determination of immunogenic epitopes for subunit vaccine design

    • Creation of attenuated strains with modified atpB for live vaccines

    • Design of multi-antigen formulations including atpB components

  • Immunomodulatory Approaches:

    • Targeting of host-atpB interactions to enhance bacterial clearance

    • Modulation of inflammatory responses to reduce tissue damage

    • Compensation strategies for impaired NADPH oxidase function

This therapeutic development pathway would build upon the observations that monoclonal antibodies against surface-expressed ATPB can inhibit cancer cell proliferation , suggesting similar approaches might work against bacteria with surface-expressed atpB.

What new technologies could advance research on G. bethesdensis atpB expression and function?

Emerging technologies that could significantly advance research on G. bethesdensis atpB include:

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for precise localization of atpB

    • Live-cell imaging with fluorescent protein fusions to track atpB dynamics

    • Correlative light and electron microscopy for contextual visualization

  • Genetic Engineering Advances:

    • CRISPR-Cas9 genome editing for precise genetic manipulation

    • Inducible expression systems for temporal control of atpB expression

    • Single-cell genetic analysis of bacterial populations

  • Structural Biology Techniques:

    • Cryo-electron microscopy for high-resolution structural analysis

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural studies

    • In-cell NMR for structural analysis in native conditions

  • Systems Biology Approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Machine learning for pattern recognition in complex datasets

    • Network analysis to position atpB in broader pathogenicity mechanisms

These technological approaches would build upon and extend the proteomics technologies based on 2-DE and mass spectrometry that were employed to identify ATPB as an antigen in cancer cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.