Recombinant Granulibacter bethesdensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; GbCGDNIH1_0726; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Target Names
yidC
Target Protein Sequence
MDQKRLFLAIAISLGILLGFQGLYRHFVPEPPAAARTATNAGQGKPNNTLGAVPTDATAS QSPPPKEGARLAVDAPRVKGSISLVGARFDDLVLRDYHETVDKNSPLVRLLAPLSGDEPY YVEYGWVPEESGIATPGRDTEWKADAATLTPNKPVTLSWDNGAGLTFMLKVAVDADYMFS VTQSVRNTTGKPVVLHPYARVRRDYRPEVEGYTVLHEGLIGVVDGILHEITYKSADSDGA KNNGLAFEHASTGGWAGITDKYWLTALIPDQITSVDFSFRDTKPNGRDGYQVGIISHNPD QVAAGAESASTTHLFAGAKVVSLLDHYQAEYHIPSFWEAVDFGWFWFITRPFFYALDWLY HLVGNFGVAILIFTVLVKAAFYPLASKSYRSMSKMRLLAPKIQSLRERYKDDPTRMQQEV MQLYKAEGANPASGCLPMLLQFPIFFSLYKVIFVTIEMRHAPFFGWIHDLSAVDPTNLFN LFGLLPFDPTHISPFLHLGIWPLIMGGTMYLQQKMNPPMPDPVQARMFQFMPIIFTFMLA RFPVGLVIYWSWNNLLSIGQQWLIQRRTKLPRPELAKV
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Granulibacter bethesdensis and why is it significant in research?

Granulibacter bethesdensis is a Gram-negative bacterium that specifically infects patients with chronic granulomatous disease (CGD), a primary immunodeficiency characterized by defects in NOX2, the phagocyte NADPH oxidase. Unlike most pathogens affecting CGD patients, G. bethesdensis can cause recurrent infections after apparent clinical cure and demonstrates resistance to both oxygen-dependent and oxygen-independent phagolysosomal antimicrobial systems. This unique pathogenicity makes it a significant organism for studying persistent bacterial infections and immune evasion mechanisms .

What is YidC and what is its general function in bacterial cells?

YidC is a membrane protein insertase that plays a crucial role in facilitating the insertion of newly synthesized proteins into lipid membranes. It functions both independently and in conjunction with the Sec translocon complex. Beyond insertion, YidC also serves as a chaperone during the folding of membrane proteins. This protein is conserved across bacterial species but exhibits structural and functional variations between Gram-positive and Gram-negative bacteria .

How does G. bethesdensis evade host immune responses?

G. bethesdensis has evolved sophisticated mechanisms to evade host immunity. Studies show that while the bacterium initially colocalizes with early endosome antigen 1 (EEA1)-positive compartments and subsequently with LAMP1-positive and LysoTracker-positive late phagosomes in macrophages, it resists elimination. Despite localization to acidified late phagosomes, viable G. bethesdensis cells can be recovered from macrophages in numbers greater than the initial input for up to 6 days post-infection. The organism remains within membrane-bound compartments throughout this period, sometimes showing evidence of division, indicating resistance to both oxygen-dependent and oxygen-independent phagolysosomal antimicrobial systems .

What are the key structural differences between YidC in Gram-negative and Gram-positive bacteria?

The YidC protein in Gram-negative bacteria contains additional structural elements not present in its Gram-positive counterpart. Most notably, Gram-negative YidC possesses a periplasmic domain (PD) and a cytoplasmic C2 loop. Molecular dynamics simulation studies have shown that these additional structures significantly contribute to the protein's stability and function. The C2 loop plays a role in stabilizing the transmembrane (TM) region and exerts allosteric influence on the PD region. Despite these differences, certain conserved features exist across both types, such as the critical arginine residue (R366 in Gram-negative, R72 in Gram-positive) within the hydrophilic groove .

What are the critical molecular interactions that stabilize YidC in the membrane?

YidC is anchored within the lipid bilayer through several critical interactions:

  • Interfacial aromatic residues

  • A cytoplasmic salt-bridge group

  • A periplasmic helix enhanced with aromatic residues

  • The highly conserved arginine residue (R366 in Gram-negative bacteria, R72 in Gram-positive bacteria) located in the hydrophilic groove

Additionally, a group of aromatic residues around R72/R366 may interact with incoming peptides during their insertion into the lipid bilayer. The hydrophilic groove within the membrane core of YidC facilitates the integration of hydrophilic moieties of substrate proteins into the membrane .

What molecular dynamics simulation approaches are most effective for studying YidC function?

Based on recent research, microsecond-level all-atom molecular dynamics (MD) simulations have proven highly effective for investigating the structural dynamics and functional mechanisms of YidC. The research protocol typically involves:

  • Construction of multiple models of YidC embedded in lipid bilayers

  • Utilization of the CHARMM36m force field with the NAMD software package

  • Analysis of simulations focusing on:

    • Root mean square deviation (RMSD) to track conformational changes

    • Principal component analysis (PCA) to identify significant differences between systems

    • Examination of specific interactions between domains

This approach has successfully characterized the critical roles of the C2 loop and periplasmic domain in Gram-negative YidC, revealing their contributions to protein stability and function .

How can researchers effectively produce and purify recombinant G. bethesdensis YidC for structural studies?

While the search results don't specifically address the production and purification of recombinant G. bethesdensis YidC, a methodological approach based on related research would include:

  • Gene cloning: Amplification of the yidC gene from G. bethesdensis genomic DNA and insertion into an appropriate expression vector.

  • Expression system selection: Using bacterial expression systems like E. coli strains optimized for membrane protein expression.

  • Purification strategy:

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization using mild detergents (e.g., DDM, LDAO)

    • Affinity chromatography utilizing engineered tags

    • Size exclusion chromatography for final purification

Protein quality can be assessed using techniques such as circular dichroism spectroscopy to confirm proper folding before proceeding to structural studies.

How does G. bethesdensis infection manifest in patients with CGD?

G. bethesdensis infection in CGD patients primarily manifests as prolonged fever and necrotizing lymphadenitis. The clinical presentation often resembles staphylococcal lymphadenitis but with a more extended duration before detection. Histopathological examination of affected tissues reveals necrotizing granulomatous inflammation, though staining typically fails to detect the organisms due to their sparse presence. The infection can become chronic and recurrent, with some patients experiencing relapses months to years after apparent clinical cure .

What approaches are effective for detecting G. bethesdensis in clinical samples?

Detection of G. bethesdensis in clinical samples can be challenging due to its slow growth and sparse presence. Effective approaches include:

  • Culture methods: Growth on various media including Middlebrook 7H11, BCYE, and fungal media, though growth is typically sparse and can take up to 3 weeks.

  • Molecular detection: PCR amplification of specific G. bethesdensis genetic markers from fresh tissue, which can provide faster diagnosis than culture methods.

  • 16S rDNA sequencing: For definitive identification once the organism is isolated.

  • Comparative genomic hybridization: Essential for differentiating between relapse with the same strain versus reinfection with a different strain .

What treatment strategies have shown efficacy against G. bethesdensis infections?

G. bethesdensis demonstrates multidrug resistance, making treatment challenging. Effective approaches have included:

  • Surgical intervention to remove infected tissue

  • Combination antimicrobial therapy, with ceftriaxone showing particularly good clinical responses

  • Alternative agents that have shown some efficacy include meropenem, aminoglycosides, doxycycline, and trimethoprim/sulfamethoxazole in various combinations

  • Long-term antimicrobial therapy may be required due to the organism's ability to persist in a clinically latent state

How does the Sec-independent insertion mechanism of YidC differ between Gram-positive and Gram-negative bacteria?

The Sec-independent insertion mechanism in Gram-positive bacterial YidC involves several conformational changes, including widening of the transmembrane region and hydration/dehydration cycles of the hydrophilic groove. While this mechanism has been extensively studied in Gram-positive bacteria, the comparable mechanism in Gram-negative bacteria, particularly the role of the additional periplasmic domain, remains less understood.

Based on molecular dynamics simulations, the Sec-independent insertion in Gram-negative YidC likely involves:

  • Interactions between the C2 loop and incoming peptides

  • Allosteric communication between the cytoplasmic loops and the periplasmic domain

  • Salt-bridge interactions involving the conserved arginine residue (R366)

  • Conformational changes influenced by both the PD region and C2 loop

The significant conformational differences observed when the C2 loop is removed suggest its crucial role in the insertion mechanism, potentially more influential than the PD region itself .

What molecular factors contribute to G. bethesdensis persistence within macrophages?

G. bethesdensis demonstrates remarkable ability to persist within macrophages, even in acidified late phagosomes. While the complete mechanism remains to be elucidated, several factors likely contribute:

  • Resistance to reactive oxygen species (ROS): G. bethesdensis survives in CGD patients who lack functional NOX2, but the mechanisms for resistance to oxygen-independent killing remain unclear.

  • Phagosomal adaptation: The bacterium localizes to LAMP1-positive and LysoTracker-positive compartments but resists degradation.

  • Potential replication within the phagosome: Some evidence suggests G. bethesdensis can divide within the membrane-bound compartment over extended periods.

  • Metabolic adaptation: Likely altered metabolism to survive the nutrient-limited environment of the phagosome .

What are the genomic differences between G. bethesdensis isolates from different patients, and how do these correlate with virulence?

Comparative genomic hybridization has revealed significant genetic variability among G. bethesdensis isolates from different patients, despite identical 16S rDNA sequences. This genetic diversity has clinical implications:

  • Strain persistence: Multiple isolates from the same patient over extended periods (years) show identical hybridization patterns, indicating persistence of the same strain.

  • Reinfection patterns: Some patients develop infections with genetically distinct strains after recovering from prior infections.

  • Familial differences: Even isolates from related patients (e.g., siblings) show distinct genomic hybridization patterns.

These genomic differences may influence virulence characteristics, though specific virulence factors have not been fully characterized. The ability of G. bethesdensis to persist in clinically latent reservoirs and cause recurrent infections months to years after apparent clinical improvement distinguishes it from other bacterial pathogens in CGD patients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.