Recombinant Granulibacter bethesdensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Research Applications

The recombinant nuoK protein serves as a tool for studying bacterial metabolism and pathogenesis:

  • Enzyme Activity Assays: Used to investigate NADH-dependent quinone reduction kinetics, particularly in the context of G. bethesdensis energy production .

  • Structural Biology: Full-length variants enable crystallization studies to map interactions with other Complex I subunits .

  • Antigen Development: Utilized in ELISA kits for detecting anti-G. bethesdensis antibodies, aiding in serological studies .

Biological Context

G. bethesdensis is a CGD-associated pathogen that resists host oxidative defenses. While nuoK itself is not directly linked to virulence, its role in the electron transport chain may contribute to bacterial survival in low-oxygen environments, such as within host macrophages . Key findings include:

  • Immune Evasion: G. bethesdensis LPS contains Ko (glycero-D-talo-oct-2-ulosonic acid), reducing proinflammatory cytokine induction compared to E. coli .

  • Intracellular Persistence: The bacterium persists in CGD monocytes and macrophages, evading non-oxidative killing mechanisms .

Comparative Analysis of Recombinant Variants

SourceHostTagPurityKey Use Cases
Creative Biomart E. coliHis-tag>90%Structural studies, ELISA
Cusabio (Baculovirus) BaculovirusUndetermined>85%Partial domain analysis
Cusabio (Yeast) YeastUndetermined>85%Functional assays

Research Implications

  • Pathogen Survival: NuoK’s role in energy metabolism may underpin G. bethesdensis adaptation to host environments .

  • Therapeutic Targets: Inhibiting Complex I could disrupt bacterial respiration, though this remains speculative .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please include them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its inclusion during development.
Synonyms
nuoK; GbCGDNIH1_1292; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Target Names
nuoK
Target Protein Sequence
MNSFMTVGLGHYLAVAAVLLVLGIFGIFLNRKNVIVMLMSIELILLAVNLNMVAFSASLG DLAGQVFAMFILTVAAAEAAIGLAILVIYFRNRGSIQVEDVNLMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, using FMN and iron-sulfur (Fe-S) centers as intermediaries. In this particular species, the immediate electron acceptor is believed to be ubiquinone. This enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Granulibacter bethesdensis and how does it relate to human disease?

Granulibacter bethesdensis is a recently described member of the Acetobacteraceae family that has been isolated from patients with chronic granulomatous disease (CGD). It is a gram-negative, aerobic, rod-shaped bacterium first isolated in 2006 from a CGD patient with lymphadenitis . Unlike many pathogens that cause acute, treatable infections, G. bethesdensis can establish persistent infections and cause recurrent disease in CGD patients even after apparent clinical resolution .

The pathogen has primarily been documented in patients with CGD, an inherited immunodeficiency caused by defects in the phagocyte NADPH oxidase that lead to impaired production of superoxide and its metabolites . G. bethesdensis appears capable of causing necrotizing lymphadenitis with fever in these patients. A notable feature of this pathogen is its ability to persist and recur months to years after apparent clinical cure, distinguishing it from other common CGD pathogens .

Genomic typing studies have confirmed that some patients experience true relapse with the identical strain, while others may be infected with genetically distinct strains in subsequent episodes, suggesting both reactivation and reinfection mechanisms occur with this organism .

What is NADH-quinone oxidoreductase and why study the nuoK subunit in G. bethesdensis?

NADH-quinone oxidoreductase (Complex I) is a crucial multisubunit enzyme in bacterial respiratory chains that couples the transfer of electrons from NADH to quinone with proton translocation across the membrane, contributing to the establishment of a proton motive force necessary for ATP synthesis. In bacteria, this complex typically contains 13-14 subunits, with nuoK being one of the membrane-embedded components involved in the proton translocation pathway.

The nuoK subunit is of particular interest in G. bethesdensis for several reasons. First, respiratory chain components are essential for energy metabolism and bacterial survival in host environments. Second, the unique persistence of G. bethesdensis in CGD patients suggests potential metabolic adaptations that might involve electron transport chain components. While CGD patients lack functional NADPH oxidase, G. bethesdensis must still overcome other host defense mechanisms and nutrient limitations, likely requiring metabolic flexibility mediated by components like nuoK .

Additionally, studies of other persistent pathogens have shown that respiratory chain components can contribute to antimicrobial resistance and adaptation to host environments with varying oxygen availability. The ability of G. bethesdensis to establish latent infection may depend partly on its capacity to modulate energy metabolism through components like nuoK .

What are the standard methods for recombinant expression of bacterial membrane proteins like nuoK?

Recombinant expression of bacterial membrane proteins requires specialized approaches due to their hydrophobic nature and structural complexity. For nuoK from G. bethesdensis, researchers typically employ the following methodological approach:

  • Expression system selection:

    • E. coli-based systems (BL21(DE3), C41(DE3), C43(DE3)) optimized for membrane protein expression

    • Cell-free expression systems that can incorporate membrane-mimicking environments

    • Yeast systems (Pichia pastoris) for eukaryotic-like post-translational modifications

  • Vector design considerations:

    • Incorporation of solubility-enhancing fusion partners (MBP, SUMO, Trx)

    • Addition of purification tags (His6, Strep-tag II) positioned to avoid interference with membrane insertion

    • Codon optimization for the expression host

    • Tunable promoter systems (T7-lac, arabinose-inducible) for controlled expression levels

  • Culture conditions optimization:

    • Lower induction temperatures (16-25°C) to slow protein synthesis and folding

    • Reduced inducer concentrations to prevent overexpression toxicity

    • Media supplementation with specific lipids that may facilitate membrane protein folding

  • Extraction and purification protocol:

    • Gentle cell lysis methods (lysozyme treatment with freeze-thaw cycles)

    • Membrane isolation through differential centrifugation

    • Detergent screening (DDM, LDAO, CHAPS) for optimal solubilization

    • Purification under conditions that maintain native structure and function

The success of recombinant nuoK expression must be verified through functionality assays, as structural integrity does not guarantee retention of biological activity. This is particularly important when studying proteins involved in electron transport chains, where interaction with other complex components is critical for function.

How can researchers investigate potential interactions between G. bethesdensis nuoK and host immune factors in CGD?

Investigating the interactions between G. bethesdensis nuoK and host immune factors requires multi-faceted approaches that integrate molecular, cellular, and immunological methods:

  • Recombinant protein interaction studies:

    • Express purified nuoK and potential host interaction partners

    • Utilize co-immunoprecipitation followed by mass spectrometry to identify binding partners

    • Employ surface plasmon resonance or microscale thermophoresis to measure binding kinetics

    • Perform yeast two-hybrid or bacterial two-hybrid screening against human immune protein libraries

  • Cellular models of CGD:

    • Develop cell lines with NADPH oxidase mutations that mimic CGD phenotypes

    • Utilize primary neutrophils and macrophages from CGD patients

    • Compare wild-type G. bethesdensis with nuoK knockout or modified strains in infection models

    • Monitor cellular outcomes including phagocytosis, phagosome maturation, and cell death pathways

  • Immunological profiling:

    • Analyze antibody responses to recombinant nuoK in serum from CGD patients with confirmed G. bethesdensis infection

    • Compare responses between patients with single episodes versus recurrent infections

    • Assess T-cell responses to nuoK epitopes using ELISPOT or intracellular cytokine staining

    • Create epitope maps to identify immunodominant regions of nuoK

Research has shown that G. bethesdensis elicits specific antibody responses in CGD patients, with multiple immunodominant antigens identified through techniques like 2-dimensional PAGE, immunoblotting, and mass spectrometry . While methanol dehydrogenase (MDH) has been identified as a major antigen, the immunoreactivity of respiratory chain components like nuoK warrants investigation, particularly given the persistent nature of G. bethesdensis infections.

The table below summarizes potential experimental approaches for investigating nuoK interactions with host factors:

Experimental ApproachTechnical MethodExpected OutcomeRelevance to CGD
Protein-protein interactionsPull-down assays, co-IPIdentification of host binding partnersMay reveal immune evasion mechanisms
Subcellular localizationImmunofluorescence microscopyDistribution of nuoK during infectionCan show targeting to specific host compartments
Host response modulationCytokine profiling, NF-κB reporter assaysImpact on inflammatory signalingMay explain granuloma formation
Antibody epitope mappingPeptide arrays, HDX-MSImmunodominant regions of nuoKCould inform diagnostic test development
In vivo infection modelsCGD mouse infection with nuoK mutantsVirulence and persistence phenotypesDirectly tests pathogenic role

What role might nuoK play in the unusual persistence of G. bethesdensis in CGD patients?

The persistence of G. bethesdensis in CGD patients months to years after apparent clinical cure represents an unusual feature for bacterial pathogens . The potential contribution of nuoK to this persistence may involve several mechanisms:

  • Metabolic adaptation to host environments:

    • NADH-quinone oxidoreductase complex allows for energy generation under varying oxygen conditions

    • nuoK, as a proton-translocating subunit, may contribute to maintaining membrane potential during nutrient limitation

    • Alternative electron acceptors may be utilized through respiratory flexibility, enabling survival in granulomas

  • Resistance to host antimicrobial mechanisms:

    • Modification of respiratory chain activity can alter bacterial susceptibility to oxidative and nitrosative stress

    • Energy-dependent efflux pumps may rely on the proton gradient maintained partly through nuoK function

    • Metabolic dormancy, possibly regulated through respiratory chain alterations, may contribute to antimicrobial tolerance

  • Biofilm formation and persistence:

    • Respiratory chain components have been implicated in biofilm formation in several bacterial species

    • Altered electron transport chain function may trigger stress responses that promote persistence phenotypes

    • Energy-limited environments within host tissues may select for variants with optimized respiratory complexes

Experimental evidence in CGD mice has shown that G. bethesdensis can establish long-term infection with pathologic changes, while being essentially nonpathogenic in wild-type mice . In one documented case, bacteria could be cultured from the spleen 76 days after infection. This animal model could serve as a platform for testing the role of nuoK through comparative studies with knockout or modified strains.

The observation that some patients experience true relapse with identical strains rather than reinfection strongly suggests that G. bethesdensis can establish a reservoir within the host, potentially adopting a dormant state that requires specific metabolic adaptations involving respiratory chain components like nuoK.

What structural and functional assays are most appropriate for characterizing recombinant G. bethesdensis nuoK?

For comprehensive characterization of recombinant G. bethesdensis nuoK, researchers should employ complementary structural and functional approaches:

Structural characterization:

  • Secondary structure analysis:

    • Circular dichroism spectroscopy to confirm alpha-helical content expected in transmembrane proteins

    • Fourier-transform infrared spectroscopy (FTIR) to assess secondary structure in membrane environments

    • Protein thermal shift assays to evaluate stability in different detergents and conditions

  • Tertiary structure determination:

    • X-ray crystallography following optimization of crystallization conditions (challenging for membrane proteins)

    • Cryo-electron microscopy, particularly if nuoK can be expressed within the complete Complex I

    • NMR studies of isotopically labeled protein for solution structure determination

    • Cross-linking mass spectrometry to identify spatial relationships with other subunits

  • Membrane topology mapping:

    • Substituted cysteine accessibility method (SCAM)

    • Protease protection assays combined with mass spectrometry

    • Fluorescence resonance energy transfer (FRET) between labeled positions

Functional characterization:

  • Proton translocation assays:

    • Reconstitution into proteoliposomes with pH-sensitive fluorescent dyes

    • Solid-supported membrane electrophysiology

    • Potentiometric measurements in reconstituted systems

  • Complex assembly analysis:

    • Blue native PAGE to assess integration into the full Complex I

    • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

    • Immunoprecipitation with antibodies against other Complex I components

  • Electron transfer measurements:

    • NADH oxidation kinetics in membrane preparations

    • Ubiquinone reduction activity using spectrophotometric methods

    • Oxygen consumption measurements in reconstituted systems

When designing these experiments, researchers should consider the challenges presented by the multimeric nature of Complex I, as nuoK functions within the context of this larger complex. Expression of nuoK alone may not recapitulate its native function, necessitating co-expression with interacting subunits or reconstitution approaches.

How might structural insights into G. bethesdensis nuoK inform potential therapeutic strategies for persistent infections?

Structural and functional characterization of G. bethesdensis nuoK could significantly impact therapeutic development through several avenues:

  • Structure-based inhibitor design:

    • Identification of nuoK sites crucial for proton translocation

    • In silico screening of compound libraries against defined binding pockets

    • Fragment-based drug design targeting interface regions between nuoK and other subunits

    • Development of peptidomimetics that disrupt essential protein-protein interactions

  • Bacterial metabolism targeting:

    • Respiratory chain inhibitors specifically designed for G. bethesdensis biochemistry

    • Compounds that exploit differences between human and bacterial complex I

    • Metabolic modulators that prevent adaptation to host environment conditions

  • Host-directed therapeutic approaches:

    • Enhancement of residual immune functions in CGD patients that can target respiratory chain components

    • Identification of host factors that interact with nuoK to develop blocking strategies

    • Immunomodulatory approaches that specifically enhance clearance of persistent bacteria

The therapeutic relevance is supported by clinical observations that G. bethesdensis is multidrug-resistant, with documented infections requiring surgery and combination antimicrobial therapy, including long-term ceftriaxone . The ability of this organism to establish persistent infection despite treatment highlights the need for novel therapeutic approaches.

Researchers investigating nuoK as a therapeutic target should consider the following experimental path:

Research PhaseKey MethodsExpected OutcomesClinical Translation Potential
Target validationGene knockout, complementationConfirmation of nuoK essentialityValidates therapeutic approach
Structural characterizationCryo-EM, X-ray crystallographyAtomic-level structure of nuoKEnables structure-based drug design
Functional analysisSite-directed mutagenesis, biochemical assaysIdentification of critical residuesDefines optimal inhibition sites
High-throughput screeningBacterial growth inhibition, enzyme assaysLead compound identificationProvides starting points for optimization
Lead optimizationMedicinal chemistry, SAR studiesImproved potency and specificityDevelops drug-like compounds
Preclinical testingInfection models, pharmacokineticsEfficacy in CGD mouse modelSupports progression to clinical studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.