Recombinant Granulibacter bethesdensis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Granulibacter bethesdensis

Granulibacter bethesdensis is an emerging Gram-negative bacterial pathogen, particularly known for causing infections in patients with chronic granulomatous disease (CGD) . CGD is an immunodeficiency characterized by impaired phagocyte NADPH oxidase function, which leads to increased susceptibility to infections . Unlike typical organisms that infect CGD patients, G. bethesdensis can cause relapses after treatment, making it a challenging pathogen to manage . Infections caused by G. bethesdensis often manifest as fever and necrotizing lymphadenitis .

Genomic Characteristics and Identification

Granulibacter bethesdensis isolates can be identified through comparative genomic hybridization, which reveals genetic variability among different strains . While isolates may appear phenotypically similar and share 100% identity in full-length 16S rDNA sequencing, comparative genomic hybridization patterns often show unique profiles, indicating distinct strains . This genetic diversity is crucial for understanding the persistence, recurrence, and reinfection patterns of G. bethesdensis in patients .

Pathogenicity and Immune Response

Granulibacter bethesdensis exhibits unique interactions with the human immune system. Compared to Escherichia coli, intact G. bethesdensis is hypostimulatory, requiring 10 to 100 times more colony-forming units per milliliter (CFU/mL) to induce cytokine production in human blood . The bacterium's lipopolysaccharide (LPS), particularly its lipid A component, contributes to its pathogenicity . The release of lipid A from G. bethesdensis LPS requires strong acid, unlike typical Enterobacteriaceae .

The structure of G. bethesdensis lipid A includes a tetra-saccharide substituted with five acyl chains: N-3′ 14:0(3-OH), N-2′ 16:0(3-O16:0), N-2 18:0(3-OH), O-3 14:0(3-OH), and 16:0 . The presence of glycero-d-talo-oct-2-ulosonic acid (Ko) as the first constituent of the LPS core region may account for the acid resistance of GbLPS . Additionally, Ko and the presence of only five acyl chains may explain the lower proinflammatory potency of GbKo–lipid A compared to E. coli lipid A . These structural properties likely contribute to immune evasion and resistance to antimicrobial peptides, aiding in the bacterium's pathogenesis .

Treatment and Clinical Management

Due to its multidrug-resistant nature, therapy for G. bethesdensis infections often requires a combination of surgery and antimicrobial drugs, including long-term ceftriaxone . The ability of G. bethesdensis to achieve clinical latency over prolonged periods within the human host, even without causing signs or symptoms, further complicates treatment strategies .

Research on Microbiota-Derived Metabolites

Research has also explored microbiota-derived metabolites, such as pyrazinones and dihydropyrazinones, which are encoded by nonribosomal peptide synthetase gene clusters in gut bacteria . These metabolites, produced by bacteria like Ruminococcus sp., exhibit protease inhibitory activity and selectively target cathepsins in human cell proteomes .

Table 1: Comparative Analysis of Granulibacter bethesdensis and Escherichia coli

FeatureGranulibacter bethesdensisEscherichia coli
Gram StainNegativeNegative
HostPatients with CGDVarious
Cytokine ProductionHypostimulatoryHigh Stimulatory
Lipid A ReleaseRequires Strong AcidTypical
Proinflammatory PotencyLowerHigher
Multidrug ResistanceYesVariable

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
crcB; GbCGDNIH1_1541; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Target Names
crcB
Target Protein Sequence
MMSYLIVFFGAGIGGMARHMVNLTAMRWGLTEFPFGTLFINMLGSFLIGAVVETFALKAG LPQHWRLFLTTGILGGFTTFSAFSLETVLLYERGKVFLAASYAVASVTLSVGALLLALHL VRTLIRG
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Granulibacter bethesdensis and why is it significant in research?

Granulibacter bethesdensis is a recently described gram-negative bacterium belonging to the Acetobacteraceae family. It has emerged as a significant pathogen in patients with Chronic Granulomatous Disease (CGD), causing fever and necrotizing lymphadenitis. Unlike typical CGD pathogens, G. bethesdensis can cause relapses after apparent clinical resolution, presenting a unique research interest . The organism has been isolated from at least 6 CGD patients from North America, Central America, and Spain, with varying clinical presentations from prolonged fever to fatal infection . Its persistence in immunocompromised hosts makes it an important model for studying bacterial survival strategies against host immune responses.

How is recombinant G. bethesdensis CrcB protein typically produced for research?

Recombinant production of G. bethesdensis CrcB protein typically employs E. coli expression systems . The standard methodology involves:

  • Cloning the full-length crcB gene (encoding amino acids 1-127) into an expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Purifying the protein using affinity chromatography

  • Performing quality control assessment including SDS-PAGE to confirm >90% purity

The resulting lyophilized protein preparation can be reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL, with recommendation to add 5-50% glycerol for long-term storage stability at -20°C/-80°C .

How might the CrcB homolog contribute to G. bethesdensis pathogenesis in CGD patients?

While direct evidence linking CrcB to G. bethesdensis pathogenesis is limited, several mechanistic hypotheses can be proposed based on current understanding:

The putative fluoride transporter function of CrcB may contribute to bacterial survival under stress conditions encountered during host infection. Fluoride resistance could potentially provide a selective advantage in certain microenvironments of CGD patients . Additionally, G. bethesdensis demonstrates unusual persistence in CGD patients, with genomic typing showing that some patients experienced recurrent infections months to years after apparent clinical cure . This persistence might be partially attributable to membrane transport proteins like CrcB that help maintain cellular homeostasis under adverse conditions.

The organism's multidrug resistance, documented in clinical isolates, may involve multiple transport proteins including CrcB, contributing to treatment difficulties that necessitate combination antimicrobial therapy and surgical intervention . Research comparing recurrent isolates from the same patient could help determine whether mutations in crcB correlate with changes in antimicrobial resistance profiles.

What experimental approaches are most informative for studying CrcB protein-protein interactions?

Several complementary approaches are recommended for studying CrcB protein-protein interactions:

  • Co-immunoprecipitation assays: Using anti-His antibodies to pull down His-tagged CrcB and identify binding partners by mass spectrometry

  • Bacterial two-hybrid systems: Particularly useful for membrane proteins like CrcB

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to capture transient interactions

  • FRET/BRET assays: For studying interactions in living cells when fluorescent protein fusions don't disrupt function

  • Surface plasmon resonance: For quantitative binding kinetics of purified protein with potential partners

When studying interactions within the bacterial membrane, researchers should consider detergent selection carefully, as inappropriate detergents can disrupt native interactions. Validation of potential interactions should be performed using multiple methodologies and include appropriate negative controls.

What are the optimal conditions for functional studies of recombinant CrcB protein?

For optimal functional characterization of recombinant G. bethesdensis CrcB protein, researchers should consider:

Reconstitution conditions: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (final concentration) is recommended .

Buffer systems: For functional studies, physiologically relevant buffers (pH 7.0-7.4) containing appropriate ions should be used. Since CrcB is a putative fluoride transporter, buffers should be tested to ensure they don't interfere with fluoride transport assays.

Membrane mimetics: As a membrane protein, CrcB requires a suitable environment to maintain its native structure. Options include:

  • Detergent micelles (mild detergents like DDM or LMNG)

  • Proteoliposomes

  • Nanodiscs

  • Amphipols

Activity assays: Fluoride transport can be measured using:

  • Fluoride-selective electrodes

  • Fluorescent probes sensitive to fluoride

  • Radioisotope (18F) uptake/efflux assays

  • Growth assays in fluoride-containing media with complementation

What techniques are most useful for studying the role of CrcB in G. bethesdensis pathogenesis?

To investigate CrcB's potential role in pathogenesis, researchers should consider a multi-faceted approach:

Genetic approaches:

  • Gene knockout or knockdown studies in G. bethesdensis (challenging due to limited genetic tools)

  • Complementation studies to restore function

  • Site-directed mutagenesis of conserved residues to identify functionally important domains

Infection models:

  • CGD mouse models, which have demonstrated long-term G. bethesdensis infection with pathologic changes while wild-type mice clear the infection

  • Cell culture systems using neutrophils or macrophages from CGD patients

  • Comparative studies between wild-type and crcB mutant strains to assess virulence factors

Serological studies:
Using approaches similar to those developed for other G. bethesdensis antigens, such as methanol dehydrogenase (MDH). These could include immunoblotting and ELISA-based detection methods to evaluate immune responses to CrcB during infection .

How can researchers address protein aggregation during CrcB purification?

Protein aggregation is a common challenge when working with membrane proteins like CrcB. Recommended strategies include:

Optimization of solubilization conditions:

  • Test multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Include glycerol (5-20%) in buffers to promote stability

  • Adjust ionic strength and pH to optimize solubility

  • Consider adding specific lipids that might stabilize the protein

Purification modifications:

  • Use gradient elution during affinity chromatography

  • Include size exclusion chromatography as a final purification step to remove aggregates

  • Maintain cold temperatures throughout the purification process

  • Consider fusion partners that enhance solubility

  • Reduce protein concentration during critical steps to minimize aggregation

Storage considerations:

  • Store at -80°C in small aliquots to avoid freeze-thaw cycles

  • Include glycerol (ideally 50%) in storage buffer

  • Consider flash-freezing in liquid nitrogen to preserve protein structure

  • Monitor protein quality by analytical size exclusion chromatography before use

What controls are essential when studying CrcB in pathogenesis models?

When investigating the role of CrcB in pathogenesis models, several controls are crucial:

Genetic controls:

  • Wild-type G. bethesdensis strain

  • crcB knockout/mutant strain

  • Complemented mutant strain (restoring wild-type crcB)

  • Strains expressing mutated versions of crcB with altered function

Host model controls:

  • When using CGD mouse models, include both CGD and wild-type mice to differentiate pathogen-specific from host-specific effects

  • For in vitro studies, compare cells from CGD patients with those from healthy donors

  • Include positive control pathogens known to cause CGD infections (S. aureus, B. cepacia complex)

Technical controls:

  • Multiple clinical isolates to account for strain variation

  • Carefully matched inoculum sizes across experimental groups

  • Monitoring of bacterial burden in tissues over time

  • Assessment of immune response parameters

  • Documentation of clinical and histopathological findings similar to those observed in human cases (necrotizing lymphadenitis)

What specific research findings exist regarding G. bethesdensis infections in CGD patients?

Key research findings regarding G. bethesdensis infections include:

FindingDetailsReference
Clinical PresentationFever and necrotizing lymphadenitis
Recurrence PatternUnlike typical CGD pathogens, can recur after clinical quiescence
Genomic AnalysisComparative bacterial genomic hybridization characterized 11 isolates from 5 CGD patients
Recurrent Infection3 patients had recurrent infection months to years after apparent clinical cure
Strain Characterization2 patients infected with same strain as previously, 1 with genetically distinct strain
Antimicrobial ProfileMultidrug resistant, requiring surgery and combination antimicrobial drugs
Treatment ResponseLong-term ceftriaxone was part of successful treatment regimen
Serological FindingsHigh prevalence of seroreactivity: 45.1% of CGD patients and 24.7% of healthy donors
Antigen IdentificationMethanol dehydrogenase (MDH) and formaldehyde-activating enzyme recognized
Mouse ModelInfection of CGD mice confirmed acquisition of high-titer antibody-recognizing MDH

How can researchers effectively differentiate between specific and non-specific effects in CrcB inhibition studies?

To distinguish between specific and non-specific effects in CrcB inhibition studies, researchers should implement:

Dose-response relationships:

  • Establish clear dose-dependent effects of putative inhibitors

  • Calculate IC50 values for quantitative comparison

  • Compare potency across related compounds to establish structure-activity relationships

Specificity controls:

  • Test effects on related transport proteins

  • Evaluate effects on bacteria with and without crcB

  • Use site-directed mutagenesis to create binding site variants

  • Develop resistance mutations and characterize cross-resistance profiles

Mechanistic validation:

  • Perform direct binding assays (isothermal titration calorimetry, surface plasmon resonance)

  • Establish correlation between binding affinity and functional inhibition

  • Use structural biology approaches (if available) to confirm binding mode

  • Develop specific antibodies against CrcB for immunological confirmation of target engagement

Studies comparing extracts from G. bethesdensis with other Acetobacteraceae species have demonstrated unique patterns of immunoreactive bands specific to Granulibacter organisms . Similar approaches could be developed for CrcB to distinguish specific from non-specific interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.