Recombinant Granulibacter bethesdensis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Overview of Granulibacter bethesdensis as a Pathogen

Granulibacter bethesdensis represents a relatively newly described genus and species within the family Acetobacteraceae, a bacterial family primarily known for acetic acid production from ethanol . This organism has emerged as a significant human pathogen, particularly in patients with Chronic Granulomatous Disease (CGD) – an inherited immunodeficiency characterized by defective phagocyte NADPH oxidase function . The pathogen has demonstrated a concerning ability to persist in human hosts over extended periods, with genetically identical strains being isolated from the same patient years apart, suggesting a capacity for long-term survival within the host .

The genome of Granulibacter bethesdensis contains 2,708,355 base pairs organized in a single circular chromosome, encoding approximately 2,437 putative open reading frames (ORFs) . Of these, 1,470 share sequence similarity with ORFs found in the non-pathogenic but related Gluconobacter oxydans, while 967 are unique to G. bethesdensis . These unique ORFs include genes potentially important for virulence, adherence, DNA uptake, and metabolic functions such as methanol utilization .

Pathogenic Properties and Host Interactions

G. bethesdensis exhibits several properties that contribute to its pathogenicity. The bacterium demonstrates resistance to serum-mediated killing, antimicrobial peptides, and can resist non-oxidative killing mechanisms deployed by polymorphonuclear leukocytes (PMN) from CGD patients . A particularly concerning characteristic is its ability to extend the survival of PMNs while potentially establishing persistent infections within longer-lived macrophages and monocytes .

Clinical manifestations of G. bethesdensis infection typically include fever and lymphadenitis, with the organism being isolated from lymph nodes of infected patients . The organism's ability to cause recurrent infections with prolonged periods of waxing and waning seropositivity suggests sophisticated immune evasion mechanisms .

Molecular Structure and Characteristics of Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase, encoded by the uppP gene (previously designated as bacA), is an extremely hydrophobic membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP) . This enzymatic activity is essential for recycling the lipid carrier required for bacterial cell wall biosynthesis.

Biological Function and Significance

The primary function of Undecaprenyl-diphosphatase is the dephosphorylation of undecaprenyl pyrophosphate to produce undecaprenyl phosphate, which serves as a critical lipid carrier in bacterial cell wall biosynthesis . This enzymatic activity represents a crucial step in the recycling phase of the lipid II cycle, which is essential for peptidoglycan synthesis in bacterial cell walls.

Role in Cell Wall Biosynthesis

Bacterial cell wall synthesis involves the transport of peptidoglycan precursors from the cytoplasm to the periplasmic space by a lipid carrier called undecaprenyl phosphate (UP). After delivering its cargo, the carrier is released as undecaprenyl pyrophosphate (UPP), which must be dephosphorylated back to UP to continue the cycle . The uppP enzyme catalyzes this essential dephosphorylation step, allowing the lipid carrier recycling process to continue .

This recycling pathway is particularly critical because the de novo synthesis of undecaprenyl phosphate is energetically costly for bacteria. Efficient recycling mediated by uppP helps maintain an adequate supply of the lipid carrier for continuous cell wall synthesis, even under stress conditions .

Relationship to Antibiotic Resistance

The uppP enzyme plays a significant role in bacterial resistance to certain antibiotics, particularly bacitracin . Bacitracin's mechanism of action involves sequestering undecaprenyl pyrophosphate (UPP), which prevents its recycling and subsequently inhibits cell wall synthesis . By increasing the dephosphorylation of UPP to UP, elevated levels of uppP can effectively reduce the pool of UPP available for bacitracin binding, thereby conferring resistance to this antibiotic .

The connection between uppP and bacitracin resistance is evidenced by the fact that the gene was initially named bacA due to the observation that its overexpression resulted in bacitracin resistance in Escherichia coli . Research has shown that the level of undecaprenyl pyrophosphate phosphatase activity increased by 280-fold in cells carrying bacA (uppP) on a multicopy expression plasmid, confirming the direct relationship between enzyme levels and potential for antibiotic resistance .

Recombinant Production and Characteristics

Recombinant Granulibacter bethesdensis Undecaprenyl-diphosphatase (uppP) can be produced through molecular cloning and protein expression systems, making it available for research applications and potentially for commercial use.

Expression and Purification Considerations

The recombinant protein is typically supplied in quantities of approximately 50 μg, with other quantities available as needed . The expression system likely requires optimization to accommodate the highly hydrophobic nature of the protein, and the tag type may vary depending on the specific production process employed .

For storage stability, the recombinant protein is typically maintained in a Tris-based buffer with 50% glycerol, optimized specifically for this protein . Storage recommendations include keeping the protein at -20°C for regular storage, or at -80°C for extended preservation . To maintain optimal activity, repeated freezing and thawing should be avoided, with working aliquots preferably stored at 4°C for up to one week .

Role in G. bethesdensis Pathogenicity

The uppP enzyme likely contributes to the pathogenicity and persistence of Granulibacter bethesdensis in several ways, though direct evidence for its specific role in this organism is limited in the available search results.

Contribution to Bacterial Survival and Persistence

Based on the known functions of uppP in other bacteria, we can infer that in G. bethesdensis, the enzyme contributes to cell wall integrity and antibiotic resistance . The capacity of G. bethesdensis to persist in human hosts over extended periods, as evidenced by the isolation of genetically identical strains from patients years apart, suggests robust cell wall maintenance mechanisms .

The genome analysis of G. bethesdensis revealed potential virulence factors and mechanisms for environmental adaptation that may work in concert with uppP to enhance bacterial survival . The bacterium's resistance to various killing mechanisms, including antimicrobial peptides which often target bacterial cell envelope components, further suggests a well-maintained cell wall structure in which uppP likely plays a critical role .

Potential Therapeutic Target

The essential nature of uppP in bacterial cell wall synthesis makes it a potential target for novel therapeutics against G. bethesdensis infections, which have proven difficult to treat in CGD patients . Interferon-γ (IFN-γ) treatment has shown some efficacy in enhancing killing of G. bethesdensis by normal monocytes and monocyte-derived macrophages, but CGD cells demonstrate reduced bacterial killing capacity even with IFN-γ treatment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
uppP; GbCGDNIH1_0871; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Target Names
uppP
Target Protein Sequence
MRIESMNAIQAIAIAILQGATELFPVSSLGHAVVLPALLGWSLPQHSQTFLPFLVFLHLG TAAALLLYFWRDWWALFSGVIGFAPAHHVPQARRIFMLLVVATLPAIVVGGLLEHMLRAL FESAPIAAFFLVVNGGLLLFGEKLRGAASPYPQTSDHEVTERRALSTLTVMDAFTIGCWQ CAALIPGISRSGATIVGGLLRGIDHEASAHFSFLIALPIILGATVLEVPKLLHADIAPGV FQTAALAAVAAGITAWLSTAFLMRYFRDHDSWALKPFAFYCIIAGLGALAWLHFA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Granulibacter bethesdensis and why is it significant for uppP research?

Granulibacter bethesdensis is a Gram-negative bacterial pathogen belonging to the Acetobacteraceae family that causes infection specifically in patients with chronic granulomatous disease (CGD), a genetic disorder characterized by deficiency in phagocyte NADPH oxidase . This organism has demonstrated remarkable persistence in infected CGD patients, with genetically identical strains being isolated from the same patient over years .

G. bethesdensis exhibits significant resistance to serum, CGD polymorphonuclear leukocytes (PMN), and antimicrobial peptides, indicating robust defense mechanisms against non-oxidative killing pathways . This persistence and resistance make G. bethesdensis an excellent model for studying bacterial membrane proteins, including undecaprenyl-diphosphatase (uppP), which plays a crucial role in cell wall biosynthesis.

What is the function of undecaprenyl-diphosphatase (uppP) in bacterial physiology?

Undecaprenyl pyrophosphate phosphatase (uppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate . This reaction is critical because undecaprenyl phosphate serves as an essential carrier lipid in bacterial cell wall synthesis .

The enzyme functions at a key junction in peptidoglycan synthesis, where it:

  • Recycles undecaprenyl pyrophosphate back to undecaprenyl phosphate

  • Makes the carrier lipid available for new rounds of cell wall precursor translocation

  • Maintains membrane integrity during bacterial growth and division

As a membrane-embedded enzyme, uppP represents a crucial part of the bacterial cell wall biosynthetic pathway, which has no counterpart in mammalian systems, making it an attractive target for antimicrobial development .

How does uppP contribute to Granulibacter bethesdensis pathogenicity?

The role of uppP in G. bethesdensis pathogenicity can be understood in the context of bacterial persistence and survival within host cells. G. bethesdensis demonstrates remarkable ability to:

  • Resist killing by CGD polymorphonuclear leukocytes and antimicrobial peptides

  • Survive within monocytes and monocyte-derived macrophages (MDM)

  • Resist both oxygen-dependent and oxygen-independent phagolysosomal antimicrobial systems

While the search results don't directly link uppP to these capabilities, the enzyme's role in maintaining cell wall integrity would be essential for the bacterium's survival under these conditions. The proper functioning of uppP ensures continuous peptidoglycan synthesis, which is critical for G. bethesdensis to withstand the harsh intracellular environment of phagocytes, even within acidified late phagosomes where the bacterium has been observed to persist .

What are the optimal conditions for expression of recombinant G. bethesdensis uppP?

Based on the protocols used for similar recombinant proteins from G. bethesdensis, such as ATP synthase subunit a (atpB), the following expression conditions are recommended:

Expression System:

  • E. coli expression systems have been successfully used for recombinant G. bethesdensis proteins

  • For membrane proteins like uppP, modified E. coli strains such as C43(DE3) or C41(DE3) often yield better results due to their ability to accommodate membrane protein overexpression

Expression Conditions:

  • Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Post-induction growth at lower temperatures (18-25°C) for 16-20 hours to improve proper folding

  • Supplementation with additional trace elements that may serve as cofactors for proper enzyme folding

Fusion Tags:

  • N-terminal His-tag has been successfully used for G. bethesdensis proteins

  • For membrane proteins like uppP, consider using fusion partners that enhance membrane insertion and stability such as MBP (maltose-binding protein) or SUMO

What purification strategy is most effective for obtaining functional recombinant G. bethesdensis uppP?

A multi-step purification strategy is recommended for isolating functional recombinant uppP:

Membrane Fraction Isolation:

  • Cell lysis using French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and protease inhibitors

  • Separation of membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization of membrane proteins using detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at 1-2% concentration

Affinity Chromatography:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Washing with buffer containing 20-50 mM imidazole to remove non-specific binding

  • Elution with buffer containing 250-500 mM imidazole

Size Exclusion Chromatography:

  • Final purification step using Superdex 200 or similar column

  • Buffer containing reduced detergent concentration (0.03-0.05% DDM) to maintain protein stability

Storage Conditions:

  • Similar to other G. bethesdensis proteins, aliquot and store at -80°C in buffer containing 6% trehalose and 50% glycerol to prevent freeze-thaw damage

  • Avoid repeated freeze-thaw cycles as noted for other G. bethesdensis proteins

What assays can be employed to measure uppP enzymatic activity?

Several complementary approaches can be used to assess the enzymatic activity of recombinant G. bethesdensis uppP:

Colorimetric Phosphate Detection:

  • Malachite green assay to detect released inorganic phosphate

  • Reaction conditions: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.1% DDM, 10 mM MgCl₂

  • Substrate: undecaprenyl pyrophosphate (typically 10-100 μM)

  • Incubation at 37°C for 15-30 minutes followed by color development

Radiometric Assay:

  • Use of [³²P]-labeled undecaprenyl pyrophosphate substrate

  • Separation of products by thin-layer chromatography

  • Quantification by autoradiography or phosphorimaging

HPLC-based Assay:

  • Separation of substrate and product by reverse-phase HPLC

  • UV detection at 210 nm or use of fluorescently-labeled derivatives

  • Quantification based on peak areas compared to standards

Coupled Enzyme Assay:

  • Linking phosphate release to other enzymatic reactions (e.g., purine nucleoside phosphorylase and xanthine oxidase)

  • Spectrophotometric detection of coupled reaction products

How can the structure-function relationship of G. bethesdensis uppP be evaluated?

Based on research on bacterial undecaprenyl pyrophosphate phosphatases, the following approaches can be used to evaluate structure-function relationships:

Site-directed Mutagenesis:

  • Target conserved residues based on sequence alignments with UppP homologs

  • Focus on the proposed active site motifs (E/Q)XXE and PGXSRSXXT identified in UppP homologs

  • Evaluate the impact of mutations on enzyme activity using the assays described above

Structural Analysis:

  • Homology modeling based on known UppP structures from related organisms

  • Molecular dynamics simulations to study conformational changes during substrate binding

  • If possible, X-ray crystallography or cryo-EM analysis of the purified protein

Inhibitor Studies:

  • Testing known phosphatase inhibitors for their effect on uppP activity

  • Structure-activity relationship analysis of inhibitor binding

  • Use of photoaffinity labeling to identify binding sites

Domain Analysis:

  • Creation of truncated versions to identify essential domains

  • Chimeric proteins with domains from other UppP proteins to assess functional conservation

How does uppP contribute to G. bethesdensis survival in CGD patients?

G. bethesdensis shows remarkable persistence in CGD patients, with the same strain being isolated over extended periods . Although the search results don't directly connect uppP to this persistence, we can infer its importance based on general bacterial physiology:

  • Cell Wall Integrity: UppP is essential for maintaining peptidoglycan synthesis, which provides structural integrity against host defenses .

  • Resistance Mechanisms: G. bethesdensis has been shown to resist killing by CGD polymorphonuclear leukocytes and antimicrobial peptides , which may involve cell envelope modifications dependent on UppP function.

  • Intracellular Survival: The bacterium has been observed to survive and potentially divide within membrane-bound compartments in macrophages for up to 6 days . This persistence requires continuous cell wall synthesis and repair, processes dependent on UppP activity.

  • Adaptation to Acidic Environment: G. bethesdensis colocalizes with LAMP1-positive and LysoTracker-positive late phagosomes , suggesting it can survive in acidic conditions where cell wall integrity, potentially maintained by UppP, would be crucial.

What evidence links uppP function to antibiotic resistance in G. bethesdensis?

While direct evidence linking uppP to antibiotic resistance in G. bethesdensis is not provided in the search results, the following connections can be made based on bacterial physiology and uppP function:

  • Cell Wall Targeting Antibiotics: UppP is involved in undecaprenyl phosphate recycling, which is essential for peptidoglycan synthesis . Inhibition of this process by antibiotics would disrupt cell wall formation.

  • Innate Resistance Mechanisms: G. bethesdensis demonstrates resistance to non-oxidative killing mechanisms , which may involve cell envelope modifications dependent on proper uppP function.

  • Persistence Mechanism: The ability of G. bethesdensis to persist within macrophages suggests mechanisms to evade killing by both host defenses and potentially antibiotics, which could involve cell wall modifications dependent on uppP.

The relationship between uppP and antibiotic resistance could be explored through:

  • Comparative gene expression studies between resistant and susceptible strains

  • Creation of uppP knockdown mutants to assess changes in antibiotic susceptibility

  • Evaluation of cell wall composition in strains with modified uppP expression

What is known about the active site architecture of bacterial uppP that can be applied to G. bethesdensis?

Based on studies of bacterial undecaprenyl pyrophosphate phosphatases, the active site of uppP likely contains the following features:

  • Conserved Motifs: The enzyme active site likely contains (E/Q)XXXE and PGXSRSXXT motifs as identified in E. coli UppP .

  • Catalytic Residues: Key catalytic residues would include:

    • Glutamate residues in the (E/Q)XXXE motif that likely coordinate metal ions or participate in phosphate hydrolysis

    • Serine residue in the PGXSRSXXT motif that may form part of the catalytic center

    • A histidine residue that likely participates in the catalytic mechanism

  • Periplasmic Orientation: The active site is likely oriented toward the periplasm, as suggested for E. coli UppP .

  • Transmembrane Architecture: As an integral membrane protein, G. bethesdensis uppP would have multiple transmembrane domains with connecting loops that form the active site.

The active site architecture can be further studied through:

  • Homology modeling based on related uppP structures

  • Site-directed mutagenesis of predicted catalytic residues

  • Inhibitor binding studies to map the active site topology

What computational approaches can be used to identify potential inhibitors of G. bethesdensis uppP?

Several computational approaches can be employed to identify potential inhibitors:

Structure-Based Virtual Screening:

  • Develop a homology model of G. bethesdensis uppP based on related structures

  • Perform molecular docking of compound libraries against the predicted active site

  • Prioritize compounds based on binding energy, interaction patterns, and predicted ADME properties

Pharmacophore Modeling:

  • Generate a pharmacophore model based on known phosphatase inhibitors

  • Screen virtual libraries for compounds matching the pharmacophore features

  • Validate hits through molecular docking and MD simulations

Fragment-Based Design:

  • Identify small molecular fragments that bind to different regions of the active site

  • Link compatible fragments to create higher-affinity inhibitors

  • Optimize lead compounds through iterative structure-activity relationship analysis

Molecular Dynamics Simulations:

  • Perform MD simulations of uppP with potential inhibitors to assess binding stability

  • Identify conformational changes that may affect inhibitor binding

  • Calculate binding free energies using methods such as MM/PBSA or FEP

How can cell-based screening platforms be optimized to discover specific inhibitors of G. bethesdensis uppP?

Based on the information from search result , which describes a cell-based screening platform for UppS inhibitors, a similar approach could be adapted for uppP:

Cell-Based Screening Platform Design:

  • Develop a reporter system linked to uppP activity or expression

  • Create a conditional uppP mutant strain with controllable expression

  • Establish a high-throughput assay that can detect inhibition of uppP activity

Implementation Strategy:

  • Primary Screen: Measure bacterial growth inhibition in the presence of compound libraries

  • Secondary Screen: Confirm target specificity by testing hits against strains with modified uppP expression

  • Validation: Perform biochemical assays with purified uppP to confirm direct inhibition

Advantages of This Approach:

  • Identifies compounds with good membrane permeability

  • Discovers inhibitors that are active against the native enzyme in its cellular context

  • Allows for initial assessment of compound toxicity

Potential Screening Parameters:

ParameterSpecification
StrainG. bethesdensis or surrogate expressing G. bethesdensis uppP
Culture ConditionsMinimal media, 30°C, 24-48 hour incubation
ReadoutGrowth inhibition, reporter gene expression, or cell wall integrity assay
ControlsKnown phosphatase inhibitors, uppP overexpression strains
Hit Criteria>50% inhibition at 10 μM with minimal toxicity to mammalian cells

What are the considerations for developing an in vivo infection model to study G. bethesdensis uppP function?

Development of an in vivo model to study G. bethesdensis uppP function should consider:

Model Selection:

  • CGD Mouse Models: Since G. bethesdensis primarily infects CGD patients, p47phox-/- or gp91phox-/- mice would be appropriate

  • Cell Culture Models: Primary human monocytes or monocyte-derived macrophages from CGD patients can serve as simplified models

Infection Parameters:

  • Bacterial Preparation: G. bethesdensis grown to mid-log phase in appropriate media

  • Inoculation Route: Intraperitoneal or intravenous for systemic infection

  • Dose Determination: Establish dose-response relationship to identify appropriate inoculum

Assessment Methods:

  • Bacterial Burden: Quantify CFU from tissues at various time points

  • Histopathology: Examine tissue sections for granuloma formation and inflammation

  • Immune Response: Measure cytokine profiles and immune cell recruitment

  • In vivo Imaging: Use fluorescently labeled bacteria to track infection progression

Experimental Design for uppP Studies:

  • Compare wild-type G. bethesdensis with uppP conditional mutants

  • Administer potential uppP inhibitors and assess effect on bacterial clearance

  • Analyze bacterial cell wall composition in recovered bacteria

Ethical and Practical Considerations:

  • Animal welfare concerns when using immunocompromised models

  • Containment requirements for work with G. bethesdensis

  • Duration of experiments to capture the persistent nature of G. bethesdensis infections

How can proteomics approaches enhance our understanding of G. bethesdensis uppP interactions?

Advanced proteomics approaches can reveal crucial insights about uppP interactions:

Interactome Analysis:

  • Affinity Purification-Mass Spectrometry (AP-MS): Identify proteins that physically interact with uppP

  • Proximity Labeling: Use BioID or APEX2 fused to uppP to identify neighboring proteins in the membrane

  • Cross-linking Mass Spectrometry: Capture transient interactions through chemical cross-linking

Post-translational Modifications:

  • Phosphoproteomics: Identify potential regulatory phosphorylation sites on uppP

  • Glycoproteomics: Detect glycosylation that may affect enzyme localization or activity

  • Lipidomics: Analyze lipid interactions that might regulate uppP function

Expression Profiling:

  • Quantitative Proteomics: Compare protein expression under different conditions (e.g., inside vs. outside macrophages)

  • Temporal Analysis: Track changes in uppP expression and its interactors during infection

  • Spatial Proteomics: Determine subcellular localization of uppP during different stages of infection

Functional Networks:

  • Pathway Analysis: Place uppP in the context of cell wall synthesis and modification pathways

  • Perturbation Studies: Analyze proteome changes in response to uppP inhibition

  • Host-Pathogen Interaction Mapping: Identify host factors that interact with bacterial cell wall components

What are the major challenges in crystallizing membrane proteins like G. bethesdensis uppP?

Crystallizing membrane proteins like uppP presents several significant challenges:

Protein Stability Issues:

  • Detergent Selection: Finding the optimal detergent that maintains protein stability while allowing crystal contacts

  • Lipid Requirements: Identifying specific lipids needed for structural integrity and function

  • Temperature Sensitivity: Managing temperature fluctuations that can destabilize membrane proteins

Crystallization Barriers:

  • Limited Crystal Contacts: Detergent micelles around the hydrophobic regions reduce surface available for crystal formation

  • Conformational Heterogeneity: Multiple conformational states can prevent uniform crystal packing

  • Low Expression Yields: Difficulty in obtaining sufficient quantities of pure protein for extensive crystallization trials

Technical Approaches to Overcome These Challenges:

  • Lipidic Cubic Phase (LCP) Crystallization: Alternative to detergent-based methods that provides a more native-like environment

  • Fusion Partners: Addition of crystallization chaperones like T4 lysozyme or BRIL to increase hydrophilic surface area

  • Nanobody Co-crystallization: Use of nanobodies to stabilize specific conformations

  • Detergent Screening: Systematic testing of different detergents and additives

Alternative Structural Approaches:

  • Cryo-electron Microscopy: Increasingly viable for membrane proteins without need for crystals

  • NMR Spectroscopy: For structural analysis of smaller membrane proteins or domains

  • Molecular Dynamics Simulations: To complement experimental structural data

How can the issue of protein aggregation during G. bethesdensis uppP purification be addressed?

Protein aggregation is a common challenge when working with membrane proteins like uppP. The following strategies can help address this issue:

During Expression:

  • Lower Induction Temperature: Reduce to 16-18°C to slow expression and improve folding

  • Reduce Inducer Concentration: Use lower IPTG concentrations (0.1-0.2 mM) to prevent overwhelming the membrane insertion machinery

  • Co-expression with Chaperones: Include molecular chaperones like GroEL/GroES to assist proper folding

During Extraction and Purification:

  • Detergent Optimization: Systematically test different detergents:

Detergent TypeExamplesRecommended Concentration
Mild NonionicDDM, LMNG1-2% for extraction, 0.05-0.1% for purification
ZwitterionicCHAPS, Fos-choline1-3% for extraction, 0.3-0.5% for purification
Steroid-basedDigitonin, GDN0.5-1% for extraction, 0.05-0.1% for purification
  • Buffer Optimization:

    • Include glycerol (10-20%) to stabilize the protein

    • Add specific lipids that may be required for stability

    • Maintain pH within the protein's stability range (typically pH 7-8)

  • Additive Screening:

    • Try different salt concentrations (100-500 mM NaCl)

    • Include stabilizing agents like trehalose (5-10%)

    • Add specific divalent cations that may be cofactors

During Storage:

  • Avoid Freeze-Thaw Cycles: As noted for other G. bethesdensis proteins

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, add 50% glycerol and flash-freeze in liquid nitrogen

  • Consider lyophilization with appropriate stabilizers for certain applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.