Recombinant Grapevine leafroll-associated virus 3 Protein P55 (ORF5)

Shipped with Ice Packs
In Stock

Description

Introduction

Grapevine leafroll-associated virus 3 (GLRaV-3) is a significant pathogen affecting grapevines worldwide . As the primary agent of Grapevine leafroll disease (GLD), GLRaV-3 can severely impact grape physiology, yield, and quality . The virus possesses a genome of approximately 18.4–18.6 kb with 13 open reading frames (ORFs) . Among these ORFs, ORF5 encodes the P55 protein, a key component that is drawing increased research attention .

Basic Information of Recombinant Grapevine leafroll-associated virus 3 Protein P55 (ORF5)

The protein P55, encoded by ORF5 of GLRaV-3, is a protein of approximately 55 kDa found in members of the Closteroviridae family . Recombinant forms of this protein are produced using genetic engineering techniques, often in E. coli . These recombinant proteins are valuable for research purposes, including antibody production and functional studies .

Table 1: Key Properties of Recombinant GLRaV-3 P55 (ORF5) Protein

PropertyDescription
Gene NameORF5
SynonymsORF5, Protein P55
UniProt IDO41517
SourceE. coli or Yeast
TagHis-tag (N-terminal)
Protein LengthFull Length (1-483 amino acids) or Partial
Purity>85-90% (SDS-PAGE)
FormLyophilized powder or Liquid
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to a concentration of 0.1-1.0 mg/mL, addition of 5-50% glycerol recommended for long-term storage
Storage Temperature-20°C/-80°C
Shelf LifeLyophilized form: 12 months at -20°C/-80°C; Liquid form: 6 months at -20°C/-80°C
Amino Acid SequenceMDKYIYVTGILNPNEARDEVFSVVNKGYIGPGGRSFSNRGSKYTVVWENSAARISGFTSTSQSTIDAFAYFLLKGGLTTTLSNPINCENWVRSSKDLSAFFRTLIKGKIYASRSVDSNLPKKDRDDIMEASRRLSPSDAAFCRAVSVQVGKYVDVTQNLESTIVPLRVMEIKKRRGSAHVSLPKVVSAYVDFYTNLQELLSDEVTRARTDTVSAYATDSMAFLVKMLPLTAREQWLKDVLGYLLVRRRPANFSYDVRVAWVYDVIATLKLVIRLFFNKDTPGGIKDLKPCVPIESFDPFHELSSYFSRLSYEMTTGKGGKICPEIAEKLVRRLMEENYKLRLTPVMALIIILVYYSIYGTNATRIKRRPDFLNVRIKGRVEKVSLRGVEDRAFRISEKRGINAQRVLCRYYSDLTCLARRHYGIRRNNWKTLSYVDGTLAYDTADCITSKVRNTINTADHASIIHYIKTNENQVTGTTLP HQL

Role and Significance

While the precise function of P55 is not fully understood, it is believed to play a role in virus movement or replication, similar to comparable proteins in related viruses . Phylogenetic analysis has revealed considerable genetic diversity among GLRaV-3 isolates, further complicating the functional characterization of P55 .

Research Applications

  • Protein Interaction Studies: Recombinant P55 is used in yeast two-hybrid and bimolecular fluorescence complementation assays to identify interacting proteins within GLRaV-3 .

  • Antibody Production: The recombinant protein is instrumental in generating antibodies for virus detection and diagnostics .

  • Phylogenetic Analysis: Analyzing the P55 protein sequence contributes to understanding the genetic relationships between different GLRaV-3 isolates .

Genetic Diversity and Phylogenetic Analysis

GLRaV-3 exhibits significant genetic diversity, with isolates grouped into nine monophyletic groups and four supergroups . This diversity impacts the development of reliable detection assays and necessitates continuous monitoring of viral variants .

Detection and Management

Accurate identification of GLRaV-3 is crucial for managing and controlling GLD . While techniques like ELISA are valuable for high-throughput screening, nucleotide sequence-based molecular diagnostic techniques offer greater sensitivity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF5; Protein P55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109))
Target Names
ORF5
Target Protein Sequence
MDKYIYVTGILNPNEARDEVFSVVNKGYIGPGGRSFSNRGSKYTVVWENSAARISGFTST SQSTIDAFAYFLLKGGLTTTLSNPINCENWVRSSKDLSAFFRTLIKGKIYASRSVDSNLP KKDRDDIMEASRRLSPSDAAFCRAVSVQVGKYVDVTQNLESTIVPLRVMEIKKRRGSAHV SLPKVVSAYVDFYTNLQELLSDEVTRARTDTVSAYATDSMAFLVKMLPLTAREQWLKDVL GYLLVRRRPANFSYDVRVAWVYDVIATLKLVIRLFFNKDTPGGIKDLKPCVPIESFDPFH ELSSYFSRLSYEMTTGKGGKICPEIAEKLVRRLMEENYKLRLTPVMALIIILVYYSIYGT NATRIKRRPDFLNVRIKGRVEKVSLRGVEDRAFRISEKRGINAQRVLCRYYSDLTCLARR HYGIRRNNWKTLSYVDGTLAYDTADCITSKVRNTINTADHASIIHYIKTNENQVTGTTLP HQL
Uniprot No.

Target Background

Database Links

KEGG: vg:1444468

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the genomic structure of GLRaV-3 and where does the P55 protein fit?

GLRaV-3 possesses a large positive-sense single-stranded RNA genome of approximately 18.4-18.6 kb containing 13 open reading frames (ORFs), or 12 ORFs in the case of group VI variants . The genome contains the characteristic replication gene block (RGB) and quintuple gene block (QGB) found in the family Closteroviridae . The P55 protein is encoded by ORF5, which is located within the QGB region of the genome. The genome organization of GLRaV-3 includes ORF1a and ORF1b encoding replication-associated proteins, followed by smaller ORFs including the one encoding P55, and several unique ORFs (ORF8-ORF12) that are specific to GLRaV-3 .

What is the current understanding of P55 function in viral biology?

Based on its position in the genome and comparative analysis with related viruses, P55 likely plays a role in the viral infection cycle. While the specific function is not detailed in current literature, proteins encoded by genes in similar positions in related closteroviridae often have roles in virion assembly, cell-to-cell movement, or host interactions. Protein interaction studies in GLRaV-3 have shown that various viral proteins, including movement proteins, HSP70 homologs, and coat proteins, self-interact and interact with each other , suggesting that P55 may participate in these interaction networks that facilitate viral replication and movement within the host plant.

How does GLRaV-3 genetic diversity impact P55 research?

GLRaV-3 exhibits significant genetic diversity, with several phylogenetic groups identified in global isolates . The taxonomy is undergoing changes, with proposals to adjust sequence similarity thresholds for delineating species . This genetic diversity directly impacts P55 research in several ways:

  • Sequence variations in P55 across different GLRaV-3 isolates may affect protein function and host interactions

  • Diagnostic tools targeting P55 must account for sequence variability to ensure detection of all variants

  • Comparative studies of P55 across variants can reveal conserved domains indicating functional importance

  • Expression systems for recombinant P55 must be designed based on the specific variant being studied

What expression systems are most suitable for producing functional recombinant P55?

Three main expression systems can be considered for recombinant P55 production, each with distinct advantages:

  • Bacterial expression systems: E. coli, particularly strain BL21:DE3, has been successfully used for expression of GLRaV-3 coat protein using the pRSET-C vector . For P55 expression, a similar approach would involve:

    • RT-PCR amplification of ORF5 from infected grapevine RNA

    • Cloning into an expression vector with a 6-His tag

    • Transformation into E. coli BL21:DE3

    • Induction with IPTG and purification via Ni-NTA affinity chromatography

  • Yeast expression systems: These have been effectively used for interaction studies of GLRaV-3 proteins and may provide more appropriate eukaryotic post-translational modifications.

  • Plant-based expression systems: For studies requiring native folding and post-translational modifications, plant expression systems using Nicotiana benthamiana via agroinfiltration may be optimal.

The choice depends on research objectives, with bacterial systems offering high yield (approximately 10.6 μg/mL culture medium for GLRaV-3 coat protein ), yeast systems being valuable for interaction studies, and plant systems providing the most natural cellular environment.

What purification strategies yield the highest purity and activity of recombinant P55?

A multi-step purification strategy is recommended for optimal P55 purification:

  • Affinity chromatography: For His-tagged P55, Ni-NTA resin provides efficient first-step purification, as demonstrated for GLRaV-3 coat protein .

  • Size exclusion chromatography: As a secondary step to separate monomeric P55 from aggregates and remove remaining contaminants.

  • Buffer optimization: The commercial P55 product is stored in Tris-based buffer with 50% glycerol , suggesting these conditions help maintain stability.

To preserve protein activity throughout purification:

  • Include protease inhibitors during extraction and purification

  • Maintain consistent cold temperature (4°C) throughout the process

  • Minimize exposure time to imidazole during elution from Ni-NTA

  • Add stabilizing agents (glycerol, DTT) to final storage buffer

  • Prepare small aliquots to avoid freeze-thaw cycles, which are detrimental to protein stability

What critical quality control measures should be implemented for recombinant P55?

Multiple complementary techniques should be employed to verify P55 quality:

  • SDS-PAGE analysis: To confirm the expected molecular weight of P55 (approximately 55 kDa plus any fusion tags).

  • Western blotting: Using antibodies against P55 or tag epitopes to confirm identity. This approach was successful for GLRaV-3 coat protein, which displayed a band of approximately 44 kDa including the fusion tag .

  • Mass spectrometry: For precise molecular weight determination and sequence verification.

  • Functional assays: These must be developed based on the predicted role of P55, potentially including interaction studies with other viral proteins.

  • Protein homogeneity assessment: Using dynamic light scattering or size exclusion chromatography to verify monodispersity.

  • Endotoxin testing: Particularly important if the protein will be used for antibody production or in plant cell assays.

How can yeast two-hybrid systems be optimized for studying P55 interactions?

Yeast two-hybrid (Y2H) systems have been successfully employed to investigate interactions between GLRaV-3 proteins . For optimal P55 interaction studies:

  • Vector selection: Use specialized vectors like pGBKT7-DB (bait) and pGADT7-AD (prey) as described for other GLRaV-3 protein interaction studies .

  • PCR amplification protocol:

    • Use high-fidelity DNA polymerase (e.g., Phusion High-Fidelity DNA Polymerase)

    • Include DMSO (3% final concentration) to improve amplification of GC-rich viral sequences

    • Employ a reaction mixture containing appropriate buffers, dNTPs (0.2 mM each), and primers (0.5 μM each)

  • Screening strategy:

    • Test P55 against all other GLRaV-3 proteins to map the complete interaction network

    • Include both full-length P55 and domain-specific constructs to identify interaction domains

    • Use appropriate positive controls (known interacting proteins) and negative controls (empty vectors)

  • Validation of positive interactions:

    • Confirm with reverse bait/prey configurations

    • Verify with quantitative β-galactosidase assays

    • Further validate with complementary methods like bimolecular fluorescence complementation

What protein-protein interaction networks might involve P55?

Based on studies of other GLRaV-3 proteins, P55 likely participates in complex interaction networks:

  • Interactions with structural proteins: Several GLRaV-3 proteins, including the coat protein, HSP70 homolog, and p5 movement protein, have been shown to self-interact . P55 may interact with these structural components, potentially participating in virion assembly or movement complexes.

  • Interactions with non-structural proteins: The silencing suppressor p20B interacts with multiple viral proteins including HSP70h, major coat protein, and minor coat protein . P55 may similarly interact with multiple viral proteins.

  • Host factor interactions: While not directly studied for P55, interactions with host factors would be critical for viral replication, movement, and suppression of host defenses.

The investigation of these interaction networks requires a systematic approach testing P55 against all viral proteins and selected host factors, followed by functional characterization of verified interactions.

How do BiFC assays complement Y2H in studying P55 interactions?

Bimolecular fluorescence complementation (BiFC) assays provide valuable complementary data to Y2H studies for P55:

  • Subcellular localization: Unlike Y2H, BiFC reveals where in the plant cell the protein interactions occur, providing context for P55 function.

  • In planta validation: BiFC occurs in plant cells, providing a more natural environment than yeast for studying viral protein interactions.

  • Visualization of interaction dynamics: Time-course studies can reveal when and how P55 interactions change during infection progression.

  • Detection of indirect complex formation: BiFC can sometimes detect proteins in the same complex even without direct interaction.

  • Reduced false positives: BiFC is less prone to false positives than Y2H because the interaction occurs in the natural cellular environment.

For GLRaV-3 proteins, both Y2H and BiFC approaches have been successfully employed , suggesting a combined approach would be optimal for comprehensive characterization of P55 interactions.

What are the advantages and limitations of P55-based ELISA systems?

The potential use of P55 in ELISA-based detection systems presents specific advantages and limitations:

Advantages:

  • Potential specificity for GLRaV-3 if antibodies target unique epitopes in P55

  • Possibility for recombinant production in bacterial systems, similar to GLRaV-3 coat protein

  • Opportunity to develop variant-specific detection if P55 contains variable regions across GLRaV-3 isolates

  • Cost-effective large-scale testing capability, as demonstrated for other ELISA-based virus detection systems

Limitations:

  • Expression level in infected tissues might be lower than other viral proteins like p20B, which has the most abundant sgRNA in infected tissue

  • Potential cross-reactivity with related viruses if antibodies target conserved domains

  • Virus titer fluctuations in grapevine tissues may affect detection reliability, as noted for other GLRaV-3 proteins

  • Only a few recombinant viral protein-based antisera have proven effective in ELISA detection

For optimal diagnostic development, empirical testing of P55-based ELISA would be necessary, comparing sensitivity and specificity with established methods based on coat protein or other viral targets.

How does P55 compare to coat protein as a diagnostic target?

The coat protein has been well-established as a diagnostic target for GLRaV-3, with successful recombinant expression and antibody production . Comparing P55 to coat protein as a diagnostic target:

FeatureCoat ProteinP55 (ORF5)
Expression level in infected tissueWell-documented, reliable targetLess documented, requires verification
Sequence conservation across variantsGenerally conserved but with variant-specific regionsNeeds comprehensive analysis across variants
Recombinant expressionSuccessfully expressed in E. coli with yield of ~10.6 μg/mL Feasible but requires optimization
Antibody productionProduces specific antisera with performance similar to commercial antibodies Needs empirical testing
Cross-reactivityNo unspecific or heterologous reactions against non-serologically related viruses Requires thorough evaluation
Detection method compatibilityEffective in both Western blot and DAS-ELISA Potential for multiple detection platforms but unverified

While coat protein has a proven track record, P55 might offer complementary advantages, particularly if it contains unique epitopes that could enhance detection specificity or provide variant discrimination.

What methodological considerations are critical for developing P55-based diagnostic tools?

Several methodological factors are critical when developing P55-based diagnostics:

  • Antibody development strategy:

    • Use highly purified recombinant P55 for immunization

    • Consider both polyclonal antisera for broad detection and monoclonal antibodies for specific epitopes

    • Perform thorough antibody characterization including affinity and specificity determination

  • Sampling protocol optimization:

    • Identify optimal tissues and seasons for P55 detection

    • Develop efficient extraction methods that preserve P55 integrity while removing inhibitory compounds

    • Standardize sample collection to ensure consistency

  • Assay validation requirements:

    • Test across diverse GLRaV-3 variants from different geographic regions

    • Include appropriate controls:

      • Known positive samples with confirmed GLRaV-3 infection

      • Healthy plant controls to rule out non-specific reactions

      • Cross-reactivity controls with related viruses

    • Compare sensitivity and specificity with established diagnostic methods

  • Multiplex potential:

    • Explore combining P55 detection with other viral targets for comprehensive diagnosis

    • Consider multiplexing for simultaneous variant discrimination

The successful development of P55-based diagnostics would require these considerations to ensure reliable, sensitive, and specific detection of GLRaV-3 in field and laboratory settings.

How can structural biology approaches enhance our understanding of P55 function?

Structural biology techniques can provide crucial insights into P55 function through several approaches:

These approaches would complement functional studies and could reveal unexpected structural features that inform our understanding of P55's role in GLRaV-3 biology.

What role might P55 play in virus-host interactions during infection?

Several research approaches can elucidate P55's role in virus-host interactions:

  • Subcellular localization studies: Determining where P55 accumulates in infected cells can provide clues to its function, whether in viral replication complexes, movement through plasmodesmata, or interactions with host defense mechanisms.

  • Host protein interaction screening: Using P55 as bait in yeast two-hybrid or co-immunoprecipitation studies to identify host proteins that interact with P55, potentially revealing:

    • Host factors recruited for viral replication or movement

    • Host defense components targeted by P55

    • Cellular pathways modified during infection

  • Transcriptomic and proteomic analysis: Comparing host responses in the presence or absence of functional P55 to identify affected pathways.

  • RNA-binding studies: Testing whether P55 binds specific viral or host RNAs, potentially revealing roles in genome replication, translation, or host gene silencing.

Understanding these interactions could provide insights into pathogenesis mechanisms and identify potential targets for developing resistance strategies against GLRaV-3 infection.

How might P55 contribute to developing virus resistance strategies?

P55 could contribute to virus resistance strategies through several approaches:

  • RNA interference (RNAi)-based resistance: Expressing hairpin RNAs targeting the ORF5 sequence in transgenic grapevines could trigger RNA silencing mechanisms against the viral genome. This approach would require:

    • Identification of conserved regions in ORF5 across GLRaV-3 variants

    • Optimization of hairpin RNA design for efficient silencing

    • Transformation and regeneration of grapevine plants

    • Thorough evaluation of resistance stability and durability

  • Dominant negative protein strategies: Expressing modified versions of P55 that interfere with wild-type function could disrupt viral infection. This requires detailed understanding of P55 functional domains.

  • Engineered protein decoys: Expressing proteins that mimic P55 interaction partners could sequester essential viral or host factors and inhibit infection.

  • Natural resistance sources: Screening wild Vitis species for natural resistance mechanisms targeting P55 function could identify genetic resources for breeding programs.

Each approach has advantages and limitations, and a comprehensive resistance strategy might combine multiple approaches for durable protection against GLRaV-3.

What are common technical challenges in P55 research and how can they be addressed?

Researchers working with P55 may encounter several technical challenges:

  • Protein insolubility: Viral proteins often form inclusion bodies in expression systems.
    Solution: Optimize expression conditions by lowering temperature (e.g., 16-18°C), reducing inducer concentration, and testing solubility-enhancing fusion tags.

  • Purification difficulties: Contaminants or degradation products can co-purify with the target protein.
    Solution: Implement multi-step purification strategies combining affinity chromatography with ion exchange or size exclusion chromatography, as demonstrated for other viral proteins .

  • Protein stability issues: Purified proteins may aggregate or lose activity during storage.
    Solution: Include stabilizing agents like glycerol (50%) in storage buffers , determine optimal pH and salt conditions, and prepare single-use aliquots to avoid freeze-thaw cycles.

  • Functional validation challenges: Confirming that recombinant P55 retains native function can be difficult.
    Solution: Develop multiple complementary functional assays based on predicted protein roles and compare with native viral protein when possible.

  • Cross-reactivity in immunoassays: Antibodies may recognize related viral proteins or host components.
    Solution: Thoroughly characterize antibody specificity using samples containing related viruses and healthy plant extracts, as performed for GLRaV-3 coat protein antisera .

What key controls should be included in P55 experimental workflows?

Robust experimental design for P55 research requires careful consideration of controls:

  • For recombinant expression:

    • Negative control: Host cells transformed with empty vector

    • Positive control: Expression of a well-characterized protein in the same system

    • Quality control: SDS-PAGE, Western blot with antibodies against tags or P55-specific epitopes

  • For interaction studies:

    • Self-interaction control: Testing P55 against itself, as many viral proteins self-interact

    • Negative controls: P55 tested against unrelated proteins or empty vectors

    • Positive controls: Known interaction pairs from GLRaV-3

  • For immunological detection:

    • Positive sample controls: Grapevine tissue with confirmed GLRaV-3 infection

    • Negative plant controls: Healthy grapevine tissue from the same variety

    • Cross-reactivity controls: Samples containing related but distinct grapevine viruses

  • For functional assays:

    • Dose-response testing: Using varying concentrations of P55

    • Competition assays: Using known ligands or interactors to confirm specificity

    • Mutated protein controls: Versions of P55 with alterations in predicted functional domains

Proper implementation of these controls ensures reliable and interpretable results in P55 research projects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.