Recombinant Green-light absorbing proteorhodopsin

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Green-light absorbing proteorhodopsin; GPR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-249
Protein Length
Full Length of Mature Protein
Species
Gamma-proteobacterium EBAC31A08
Target Protein Sequence
AGGGDLDASDYTGVSFWLVTAALLASTVFFFVERDRVSAKWKTSLTVSGLVTGIAFWHYM YMRGVWIETGDSPTVFRYIDWLLTVPLLICEFYLILAAATNVAGSLFKKLLVGSLVMLVF GYMGEAGIMAAWPAFIIGCLAWVYMIYELWAGEGKSACNTASPAVQSAYNTMMYIIIFGW AIYPVGYFTGYLMGDGGSALNLNLIYNLADFVNKILFGLIIWNVAVKESSNA
Uniprot No.

Target Background

Function
A light-driven proton pump generating phototrophic energy.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is green-light absorbing proteorhodopsin and what is its functional significance?

Green-light absorbing proteorhodopsin (GPR) is a retinal-based membrane protein that functions as a light-driven proton pump. It serves as the archetype of bacterial proton pumps and absorbs maximally at 520-540 nm in the green region of the visible spectrum . GPR belongs to the broader family of microbial rhodopsins (MRs) found throughout various domains of life. Its functional significance lies in its ability to generate a proton gradient across lipid membranes upon light illumination, which can be utilized for energy conversion purposes in bacterial cells . Unlike bacteriorhodopsin, GPR contains a single highly conserved histidine near the photoactive site, which plays a crucial role in its proton-pumping mechanism .

How does the oligomeric structure of GPR influence its function?

GPR naturally forms pentameric structures in the membrane, as revealed by cryo-electron microscopy studies at 2.9 Å resolution . The pentameric arrangement provides important structural scaffolding that influences the protein's dynamics and function. Research shows that helices involved in stabilizing the protomer interfaces serve as scaffolds that facilitate the motion of other helices during the protein's functional cycle . Molecular dynamics simulations have demonstrated that the pentamer exhibits more constrained dynamics compared to the monomer, which contributes to the functional significance of GPR oligomerization . The pentameric structure allows for coordinated conformational changes that regulate solvent access to the intra- and extracellular half channels containing critical residues for proton translocation .

What are the key residues involved in the proton translocation pathway of GPR?

The proton translocation pathway in GPR involves several key residues identified through structural and functional studies. The primary proton donor is E109, located in the intracellular half channel, while E143 functions as the proposed proton release group in the extracellular half channel . Molecular dynamics simulations and structural comparisons have revealed that these residues undergo conformational changes that regulate solvent access to the respective half channels, which is essential for proton movement . Additionally, GPR contains a highly conserved histidine (His-75) near the photoactive site, which serves as a novel component in the light-driven proton pumping mechanism not found in other well-studied rhodopsins like bacteriorhodopsin . Functional characterization of mutants has demonstrated the importance of the molecular organization around E109 and E143 for proper GPR activity .

What expression systems are most effective for producing recombinant GPR?

Escherichia coli has proven to be an efficient heterologous expression system for producing recombinant GPR. Similar to other microbial rhodopsins like actinorhodopsin, GPR can be efficiently overexpressed in E. coli in milligram amounts and isolated with high purity and homogeneity . The expression typically involves using standard E. coli strains with expression vectors containing the GPR gene under the control of inducible promoters. The addition of all-trans-retinal to the culture medium is crucial for the formation of functional holoprotein, as it serves as the chromophore that enables light absorption . When properly expressed, GPR integrates into the E. coli membrane and can establish a proton gradient across the membrane upon light illumination, which has been demonstrated using GPR-overexpressing E. coli cells .

How can cryo-electron microscopy be optimized for structural determination of GPR oligomers?

Optimizing cryo-electron microscopy (cryo-EM) for GPR structural determination requires careful consideration of several factors. Based on successful studies that achieved 2.9 Å resolution of pentameric GPR , researchers should focus on:

  • Sample preparation: Purify GPR in detergents that maintain oligomeric integrity, such as 5-cyclohexyl-1-pentyl-β-D-maltoside or n-octyl-β-D-glucopyranoside, which have been shown to preserve oligomeric structures of similar rhodopsins . The choice of detergent is critical as it affects protein stability and homogeneity.

  • Vitrification conditions: Optimize blotting times and grid types to achieve ice of appropriate thickness. The pentameric arrangement of GPR creates particles of sufficient size for good contrast in cryo-EM.

  • Data collection: Collect data using direct electron detectors with movie mode capability to account for beam-induced motion. For GPR, collecting thousands of micrographs may be necessary to obtain sufficient particles for high-resolution reconstruction.

  • Image processing: Apply 2D classification to separate different oligomeric states (pentamers from potential hexamers) , followed by 3D classification and refinement. Apply symmetry constraints (C5 for pentamers) during refinement to improve resolution.

  • Model building and validation: Use molecular dynamics simulations to validate the structures and gain insights into dynamic properties, as was successfully done in previous GPR structural studies .

This approach has been effective in resolving important residues of the proton translocation pathway and the oligomerization interface of GPR .

What strategies can be employed to engineer GPR variants with red-shifted absorption spectra for optogenetic applications?

Engineering GPR variants with red-shifted absorption spectra involves several sophisticated strategies:

These engineered variants with red-shifted absorption spectra are particularly valuable for optogenetic applications, membrane sensor technology, and complementation of oxygenic phototrophy .

How can molecular dynamics simulations be designed to investigate the protonation-dependent hydration of GPR's proton translocation pathway?

Designing effective molecular dynamics (MD) simulations to investigate protonation-dependent hydration of GPR's proton translocation pathway requires several specialized considerations:

  • System preparation:

    • Start with high-resolution structures (e.g., the 2.9 Å cryo-EM structure)

    • Embed GPR in a lipid bilayer that mimics the bacterial membrane composition

    • Include explicit water molecules and ions to maintain physiological conditions

    • Consider both monomeric and pentameric states for comparative analysis

  • Protonation state modeling:

    • Simulate multiple protonation states of key residues, particularly E109 (primary proton donor) and E143 (proposed proton release group)

    • Use constant pH molecular dynamics where the protonation states can change during simulation, or

    • Run parallel simulations with different fixed protonation states

  • Simulation protocols:

    • Run long simulations (>100 ns) to capture relevant conformational changes

    • Apply enhanced sampling techniques (metadynamics, umbrella sampling) to investigate energy barriers between different hydration states

    • Use polarizable force fields for more accurate representation of proton transfer events

  • Analysis methods:

    • Track water molecule penetration into the intracellular and extracellular half channels

    • Calculate water density profiles along the proton translocation pathway

    • Identify water wire formations and hydrogen-bonding networks

    • Analyze conformational changes of key residues (E109, E143, His-75) under different protonation conditions

  • Validation approach:

    • Compare simulation results with experimental data from FTIR spectroscopy

    • Validate predicted structural changes with mutational studies that demonstrate the importance of molecular organization around E109 and E143

Previous MD studies have successfully revealed that changing the protonation state of E109 triggers structural rearrangements that allow hydration of the intracellular half channel, providing a mechanism for proton translocation .

What time-resolved spectroscopic techniques are most appropriate for elucidating the photocycle intermediates of GPR?

Several time-resolved spectroscopic techniques are particularly valuable for elucidating GPR photocycle intermediates, each offering unique advantages:

  • Time-resolved FTIR difference spectroscopy:

    • Provides detailed information about protein conformational changes and protonation states of specific residues during the photocycle

    • Can be combined with isotope labeling (e.g., 15N, 13C) to identify specific amino acid contributions to the spectra

    • Allows detection of structural changes in the microsecond to second time range

    • Has been successfully used to study the role of His-75 in the PR photocycle

  • Ultrafast transient absorption spectroscopy:

    • Enables monitoring of the earliest photocycle events (femtoseconds to nanoseconds)

    • Can detect the formation and decay of primary photoproducts

    • Particularly useful for comparing wild-type GPR with variants containing retinal analogues or mutations

  • Time-resolved resonance Raman spectroscopy:

    • Provides information about retinal chromophore configuration changes during the photocycle

    • Can distinguish between all-trans and 13-cis retinal conformations

    • Useful for determining how mutations or retinal analogues affect chromophore structure

  • Flash photolysis coupled with visible absorption spectroscopy:

    • Allows detection of spectrally distinct intermediates in the microsecond to second time range

    • Can measure the kinetics of intermediate formation and decay

    • Has shown that some PR variants (e.g., RS29) have photochemical reaction cycles that are 2 orders of magnitude slower than typical GPR, with t1/2 values >600 ms

  • Electrical measurements:

    • Directly measure proton pumping activity through photocurrent recordings

    • Can correlate spectroscopic intermediates with functional proton transport

    • Have been used alongside spectroscopic techniques to study PR function

For comprehensive characterization, these techniques should be used in combination, with complementary temperature-dependent studies to trap specific intermediates. The choice of technique should be guided by the specific aspect of the photocycle being investigated.

How can researchers resolve conflicting observations about GPR oligomeric state variability?

Resolving conflicting observations about GPR oligomeric state variability requires a multi-faceted approach that addresses several potential sources of discrepancy:

  • Purification conditions analysis:

    • Systematically compare detergent effects, as different detergents can disrupt or preserve native oligomeric states

    • Examine the impact of protein concentration, pH, salt concentration, and temperature on oligomerization

    • Use size-exclusion chromatography with multiple detergents to assess oligomer stability, similar to studies with actinorhodopsin that revealed highly homogeneous oligomers even in harsh detergents like n-octyl-β-D-glucopyranoside

  • Methodological cross-validation:

    • Apply complementary structural techniques beyond cryo-EM (e.g., native mass spectrometry, analytical ultracentrifugation, FRET-based assays)

    • Use crosslinking studies with mass spectrometry to identify interaction interfaces

    • Perform functional assays across different oligomeric states to determine functional relevance

  • Sample heterogeneity assessment:

    • Employ 2D classification of cryo-EM data to quantitatively analyze particle distributions

    • Investigate whether reported pentamer and hexamer mixtures represent:
      a) Preparation artifacts
      b) Assembly intermediates
      c) Functionally distinct populations
      d) Species-specific variations

  • Dynamic equilibrium investigation:

    • Design experiments to determine if GPR exists in a dynamic equilibrium between different oligomeric states

    • Use single-molecule techniques to observe potential transitions between states

    • Examine whether specific lipid environments stabilize particular oligomeric forms

  • Mutational analysis of oligomerization interfaces:

    • Introduce mutations at predicted interface residues to destabilize specific oligomeric states

    • Compare the oligomerization properties of GPR variants from different bacterial sources

This comprehensive approach can help determine whether the observed pentamer and hexamer mixtures represent true biological variability or are consequences of experimental conditions.

How should researchers interpret differences in proton pumping efficiency between GPR variants with modified spectral properties?

Interpreting differences in proton pumping efficiency between GPR variants with modified spectral properties requires careful consideration of multiple factors that affect both spectral characteristics and pumping function:

  • Structure-function correlation analysis:

    • Compare the location of mutations relative to:
      a) The retinal binding pocket
      b) The proton translocation pathway (particularly E109 and E143)
      c) The pentameric interface regions

    • Assess whether spectral shifts correlate linearly or non-linearly with pumping efficiency changes

  • Photocycle kinetics assessment:

    • Measure photocycle kinetics for each variant to determine rate-limiting steps

    • Consider that some PR variants (like RS29) show photochemical cycles that are 2 orders of magnitude slower than typical GPR (t1/2 >600 ms) , which may indicate shifts toward regulatory rather than energy harvesting functions

    • Analyze whether retinal analogues like MMAR, which produce significant red-shifts, alter specific photocycle intermediates that affect proton transfer rates

  • Quantum efficiency determination:

    • Measure the quantum yield of photoisomerization for each variant

    • Calculate the number of protons pumped per photon absorbed

    • Distinguish between reduced efficiency due to poor photoisomerization versus impaired proton translocation

  • Chromophore-protein interaction analysis:

    • Evaluate how modified spectral properties affect:
      a) Retinal binding stability
      b) pKa values of key residues in the proton pathway
      c) Conformational changes necessary for proton translocation

    • Use FTIR difference spectroscopy to examine how mutations or retinal analogues alter proton donor/acceptor properties

  • Functional validation under diverse conditions:

    • Test proton pumping under varying:
      a) Light intensities
      b) Wavelengths
      c) pH conditions
      d) Temperature ranges

    • Determine if variants with red-shifted spectra (e.g., MMAR-containing holoproteins) retain proportional pumping efficiency under near-infrared illumination (730 nm)

This systematic approach enables researchers to distinguish mutations that primarily affect spectral properties from those that fundamentally alter the proton pumping mechanism, providing insight into the coupling between absorption characteristics and protein function.

What strategies can overcome low expression yields of recombinant GPR in E. coli systems?

Overcoming low expression yields of recombinant GPR in E. coli systems requires addressing several potential bottlenecks:

  • Codon optimization:

    • Analyze the GPR gene sequence for rare codons in E. coli

    • Synthesize a codon-optimized gene that matches E. coli codon usage preferences

    • Consider using specialized E. coli strains that supply rare tRNAs (e.g., Rosetta)

  • Expression vector optimization:

    • Test multiple promoter systems (T7, araBAD, trc) to identify optimal transcriptional control

    • Incorporate a strong ribosome binding site for efficient translation initiation

    • Include fusion tags that enhance expression and solubility (e.g., MBP, SUMO)

    • Consider using specialized vectors designed for membrane protein expression

  • Expression conditions refinement:

    • Optimize growth temperature (typically lower temperatures, 18-25°C, improve membrane protein folding)

    • Adjust induction timing based on growth phase (mid-log phase is often optimal)

    • Test various inducer concentrations to balance expression level with proper folding

    • Supplement growth media with components that enhance membrane protein expression:
      a) Glycerol (3-5%) to stabilize membranes
      b) All-trans-retinal (5-10 μM) added at induction for proper folding and chromophore incorporation
      c) Metal ions that may stabilize protein structure

  • Host strain selection:

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • BL21(DE3)pLysS to reduce basal expression that might be toxic

    • Lemo21(DE3) to tune expression levels through rhamnose-controlled T7 lysozyme production

  • Membrane capacity enhancement:

    • Co-express proteins that increase membrane production (e.g., Yidcfilamentous phage shock proteins)

    • Use protocols that induce proliferation of intracellular membranes

  • Scale-up strategies:

    • Use high cell density fermentation techniques with controlled feeding

    • Implement protocols similar to those used for actinorhodopsin, which achieved efficient expression in milligram amounts with high purity and homogeneity

By systematically addressing these factors, researchers can significantly improve recombinant GPR yields, achieving expression levels suitable for structural and functional studies.

How can researchers effectively troubleshoot non-functional GPR variants following site-directed mutagenesis?

Troubleshooting non-functional GPR variants after site-directed mutagenesis requires a systematic approach to identify whether the defect lies in expression, folding, chromophore binding, or the proton pumping mechanism:

  • Expression and localization verification:

    • Use Western blotting with anti-tag antibodies to confirm expression

    • Perform subcellular fractionation to verify membrane localization

    • Create GFP fusion constructs to visualize localization via fluorescence microscopy

    • Check for protein aggregation in inclusion bodies

  • Chromophore binding assessment:

    • Examine visible absorption spectra for the characteristic peak at 520-540 nm

    • If no absorption peak is observed:
      a) Try reconstitution with excess all-trans-retinal
      b) Use resonance Raman spectroscopy to detect even low levels of bound chromophore
      c) Check if the Schiff base linkage is properly formed using acid denaturation

  • Structural integrity evaluation:

    • Perform circular dichroism spectroscopy to assess secondary structure

    • Use limited proteolysis to probe for major structural alterations

    • Apply thermal stability assays to determine if the mutation destabilizes the protein

    • Compare detergent extraction efficiency with wild-type GPR

  • Proton pumping mechanism investigation:

    • Measure light-dependent pH changes in E. coli cells or proteoliposomes

    • Use pH-sensitive dyes or electrodes to detect even small proton movement

    • Apply patch-clamp techniques to measure photocurrents in reconstituted systems

    • Examine partial reactions of the photocycle using time-resolved spectroscopy

  • Rescue strategies for non-functional variants:

    • Introduce compensatory mutations based on structural information

    • Test alternative retinal analogues that might accommodate the structural changes

    • Modify the lipid environment to better support the mutant protein function

    • Create chimeric proteins with functional rhodopsin segments

  • Photocycle analysis:

    • Use flash photolysis to determine if the mutation blocks specific photocycle steps

    • Compare photocycle kinetics with wild-type to identify rate-limiting steps

    • Determine the primary proton donor's pKa (typically E109) in the mutant protein

    • Examine whether mutations near E109 and E143 disrupt the molecular organization critical for GPR activity

This methodical approach can help distinguish between mutations that affect fundamental structural elements versus those that specifically disrupt the proton translocation pathway or retinal binding pocket.

How can molecular engineering of GPR enable its application in light-harvesting systems for bioenergy production?

Molecular engineering of GPR for light-harvesting bioenergy applications requires strategic modifications to enhance its functionality and integration capabilities:

  • Spectral tuning optimization:

    • Engineer GPR variants with broader absorption spectra to capture more of the solar spectrum

    • Create libraries of GPR variants with complementary absorption maxima (from blue to near-infrared)

    • Incorporate retinal analogues like MMAR that extend absorption into the near-infrared region (up to 850-950 nm)

    • Develop variants with the PR-D212N,F234S double mutation that has shown exceptional red-shifting capacity when combined with retinal analogues

  • Enhancing proton gradient generation:

    • Modify key residues to increase the rate of photocycle turnover

    • Engineer variants with altered pKa values of the primary proton donor (E109) and release group (E143) to optimize proton pumping under specific pH conditions

    • Create variants with higher quantum efficiency to maximize protons pumped per photon

  • Integration with bioenergy systems:

    • Design fusion constructs that couple GPR with ATP synthase for direct light-to-ATP conversion

    • Develop systems linking GPR-generated proton gradients to hydrogenase activity for biohydrogen production

    • Engineer co-expression systems similar to the dual plasmid system that demonstrated a synergistic effect of proteorhodopsin with endogenous retinal on hydrogen production (~1.3-fold increase)

  • Stability and robustness improvements:

    • Introduce mutations that enhance thermal and pH stability

    • Engineer variants that maintain pentameric structures even under harsh conditions

    • Leverage the natural robustness seen in actinorhodopsin oligomers, which remain highly homogeneous even in harsh detergents like n-octyl-β-D-glucopyranoside

  • Optimizing expression and membrane integration:

    • Develop GPR variants with enhanced expression in diverse host organisms

    • Create synthetic operons for coordinated expression of GPR with other components

    • Design artificial membrane scaffolds that optimize GPR orientation and density

  • Light-harvesting efficiency enhancements:

    • Integrate GPR with light-harvesting antenna complexes

    • Engineer variants that can achieve conversion efficiencies of light energy to biofuel exceeding the ~3.4% reported for proteorhodopsin-enhanced biohydrogen production systems

    • Design arrays of GPR molecules optimized for maximal surface density and orientation

These engineering approaches could transform GPR from a model system into a practical component of light-driven bioenergy production platforms.

What are the current limitations in using GPR for optogenetic applications, and how might they be overcome?

Current limitations in using GPR for optogenetic applications and potential solutions include:

  • Limited tissue penetration of green light:

    • Limitation: GPR's absorption maximum (520-540 nm) limits its use in deep tissues due to poor penetration of green light.

    • Solution: Develop red-shifted variants using retinal analogues like MMAR combined with mutations like PR-D212N,F234S, which have shown absorption extending into the near-infrared (730-950 nm) . This would enable deeper tissue penetration for in vivo applications.

  • Proton pumping kinetics:

    • Limitation: Some GPR variants have slow photocycle kinetics (t1/2 >600 ms) , limiting temporal resolution for rapid neuronal control.

    • Solution: Engineer faster-cycling variants by modifying key residues in the proton translocation pathway, particularly around E109 and E143 . Structure-guided mutations could accelerate rate-limiting steps in the photocycle.

  • Expression efficiency in mammalian cells:

    • Limitation: GPR is naturally expressed in bacteria and may face expression challenges in eukaryotic systems.

    • Solution: Optimize codon usage for mammalian expression, add trafficking signals, and incorporate mammalian membrane targeting sequences. Create fusion constructs with well-expressed mammalian membrane proteins.

  • Ion selectivity:

    • Limitation: As a proton pump, GPR has limited versatility compared to cation channels used in optogenetics.

    • Solution: Engineer GPR variants with modified selectivity filters to transport other ions, similar to approaches used with channelrhodopsins. Structure-guided mutations around the proton pathway could potentially alter ion selectivity.

  • Photosensitivity and signal strength:

    • Limitation: GPR may require higher light intensities than specialized optogenetic tools.

    • Solution: Enhance quantum efficiency through mutations that optimize retinal isomerization. Increase expression levels and implement strategies to enhance membrane targeting and stability.

  • Oligomerization interference:

    • Limitation: GPR's natural pentameric structure may interfere with fusion to other proteins or integration into complex optogenetic systems.

    • Solution: Design monomeric variants by disrupting oligomerization interfaces while maintaining functionality. Alternatively, leverage the pentameric structure by engineering it as a scaffold for multiplexed optogenetic systems.

  • Chromophore availability:

    • Limitation: Mammalian cells do not naturally produce sufficient retinal for rhodopsin function.

    • Solution: Co-express enzymes for retinal synthesis or develop GPR variants with higher affinity for the limited retinal available in mammalian systems.

By addressing these limitations through molecular engineering, GPR could evolve from a model proton pump into a versatile optogenetic tool with unique capabilities complementary to existing optogenetic actuators.

What computational approaches can best predict the functional impact of mutations in the GPR proton translocation pathway?

Advanced computational approaches for predicting functional impacts of GPR mutations require integration of multiple methods:

These computational approaches, when used in combination, can provide detailed mechanistic insights into how specific mutations affect GPR function, guiding experimental design and protein engineering efforts.

What methodological approaches can best characterize the lipid-protein interactions that influence GPR function?

Characterizing lipid-protein interactions that influence GPR function requires a multi-methodological approach:

TechniqueApplication to GPRExpected Insights
Native Mass SpectrometryAnalyze GPR with bound lipidsIdentifies specific lipids that co-purify with GPR and remain bound during ionization, indicating high-affinity interactions
Hydrogen-Deuterium Exchange MSCompare exchange rates in different lipid environmentsMaps regions of GPR with lipid-dependent solvent accessibility, revealing potential lipid interaction sites
Solid-State NMRAnalyze reconstituted GPR in various lipid compositionsProvides atomic-level details of specific lipid-protein contacts and their effects on protein dynamics
EPR Spectroscopy with Site-Directed Spin LabelingMeasure mobility of spin labels at various positionsDetects how different lipid environments affect the dynamics of specific regions, particularly at the lipid-protein interface
Molecular Dynamics SimulationsModel GPR pentamers in various lipid bilayersPredicts lipid binding sites, lipid-induced conformational changes, and effects on water penetration into proton channels
Fluorescence SpectroscopyMonitor environment-sensitive probes in different lipid systemsMeasures how lipid composition affects local environments around key residues in the proton pathway
Lipid Nanodiscs with Defined CompositionReconstitute GPR in discs with controlled lipid contentEnables systematic testing of specific lipids' effects on GPR structure and function
Functional Assays in Various Lipid EnvironmentsMeasure proton pumping in different reconstituted systemsDirectly correlates lipid composition with functional outcomes
Cryo-EM in Different Lipid EnvironmentsSolve structures in various lipid compositionsVisualizes lipid-dependent structural changes, particularly in the oligomeric interfaces of the pentamer
Lipid Crosslinking and MS AnalysisIdentify covalently attached lipids after UV activationMaps specific lipid binding sites and potential regulatory lipid interactions

These methodologies would provide comprehensive insights into how lipids influence:

  • The stability and dynamics of the pentameric assembly

  • The hydration of proton translocation channels

  • The pKa values of key residues in the proton pathway

  • The kinetics of the photocycle

  • The efficiency of proton pumping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.