The Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11 (SEC11) is a recombinant protein derived from the fungus Grosmannia clavigera, which is known for its role as a symbiont of the mountain pine beetle and a pathogen of pine trees . This protein is part of the signal peptidase complex, which plays a crucial role in the processing of signal peptides during protein secretion. Signal peptides are sequences that direct proteins to specific destinations within or outside the cell, and their removal by signal peptidases is essential for proper protein function and localization.
SEC11 is a catalytic subunit of the signal peptidase complex, responsible for cleaving signal peptides from newly synthesized proteins. This process is vital for the maturation and correct targeting of secretory proteins. In organisms like Grosmannia clavigera, efficient signal peptide processing is crucial for pathogenicity and survival within host trees .
The Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11 is a recombinant protein with specific physical and chemical properties:
Molecular Formula and Weight: The exact molecular formula and weight are not specified in available sources, but the protein is known to be a full-length protein with an amino acid sequence provided .
Amino Acid Sequence: The amino acid sequence of SEC11 from Grosmannia clavigera is detailed, starting with MLSAVAKPRQLASQILNFGLILSTAFMIWKGLSVVSDSSSPIVVVLSGSMEPAFQRGDLLFLWNRNLLQETDVGEIVVYNVRGKDIPIVHRIVRKFGTGPHAKLLTKGDNNAGDDTDLYAQGQDYLERKDIVGSVVGYVPFVGYVTILLTEHPWLKKVMLGLMGVLVVLQRE .
Expression Region: The protein is expressed as a full-length protein from amino acids 1 to 172 .
The Recombinant Grosmannia clavigera Signal peptidase complex catalytic subunit SEC11 is available from suppliers like CUSABIO TECHNOLOGY LLC . The product is typically supplied in a Tris-based buffer with 50% glycerol and is stored at -20°C for extended periods .
| Product Feature | Description |
|---|---|
| Species | Grosmannia clavigera (strain kw1407 / UAMH 11150) |
| Uniprot Number | F0XJH4 |
| Tag Info | Determined during production |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Storage Conditions | Store at -20°C, avoid repeated freezing/thawing |
| Size | 50 μg (other sizes available upon request) |
| Supplier | Country | Contact |
|---|---|---|
| CUSABIO TECHNOLOGY LLC | China | cusabio@163.com |
Grosmannia clavigera (Gc) is a bark beetle-vectored fungal pathogen of pine trees that has destroyed wide areas of lodgepole pine forest in western North America, including more than 16 million hectares in British Columbia. It forms a critical component of the mountain pine beetle outbreak as both a symbiont of the beetle and a pathogen of pine trees . G. clavigera causes wood discoloration ("blue stain") in infected trees and can damage the host tree's water transport system, contributing to tree mortality . Due to its economic and ecological importance, G. clavigera has become a model organism for studying fungal-insect-plant interactions and pathogen adaptation mechanisms .
SEC11 is a catalytic subunit of the signal peptidase complex (SPC), an essential membrane complex responsible for removing signal peptides from proteins entering the secretory pathway. Based on homology to other eukaryotic systems, the G. clavigera SEC11 protein is likely involved in processing secreted proteins that may play roles in host colonization, nutrient acquisition, and defense against host immune responses .
The SEC11 gene in G. clavigera encodes a protein that belongs to the peptidase S26B family, with significant homology to the yeast SEC11 protein (47% identity in canine SEC11) . The catalytic activity of SEC11 depends on a Ser-His-Asp triad, with mutation studies in human SEC11 confirming that Asp122/134 is essential for catalytic activity while only moderately affecting protein stability .
The genome of G. clavigera is approximately 30 Mb and has been assembled into 18 supercontigs with 8,314 protein-coding genes . Genome and transcriptome analyses have revealed that G. clavigera possesses a comprehensive set of genes involved in essential metabolic pathways, including:
Complete ergosterol pathway
Nearly complete citrate and pentose phosphate cycles (missing only one gene)
59 of 95 genes necessary for primary amino acid biosynthesis
The genomic organization of G. clavigera includes specialized gene clusters that enable it to tolerate and even utilize conifer defense compounds, particularly terpenoids. These adaptations include specialized efflux transporters like GcABC-G1 and detoxification enzymes that allow the fungus to overcome host tree defenses .
While the specific structure of G. clavigera SEC11 has not been fully characterized, structural insights can be inferred from related SEC11 proteins in other organisms, particularly human SEC11A/C, which have been studied using cryo-electron microscopy . Based on homology, the G. clavigera SEC11 likely consists of:
An N-terminal transmembrane helix that anchors the protein in the endoplasmic reticulum membrane
A catalytic domain containing the Ser-His-Asp catalytic triad essential for peptidase activity
A C-terminal region that may contribute to protein-protein interactions within the signal peptidase complex
The catalytic domain of SEC11 contains several conserved sequence motifs (boxes A-E) that are characteristic of ER-type signal peptidases. The active site residues are arranged to form a catalytic pocket capable of recognizing and cleaving signal peptides from nascent proteins .
The SEC11 protein in G. clavigera shares significant homology with SEC11 proteins from other fungi and higher eukaryotes. Comparative analysis reveals:
G. clavigera SEC11 is functionally similar to the yeast (S. cerevisiae) SEC11, which is essential for signal peptide cleavage, normal rate of secretion, and cell survival
Mammalian systems have two SEC11 paralogs (SEC11A and SEC11C) that form distinct heterotetrameric complexes (SPC-A and SPC-C) with accessory subunits
The catalytic mechanism involving a Ser-His-Asp triad is conserved across species, distinguishing eukaryotic SEC11 from bacterial signal peptidases that use a Ser-Lys dyad
These evolutionary relationships suggest that the fundamental function of SEC11 in signal peptide processing has been conserved across diverse taxonomic groups, while species-specific adaptations may reflect different physiological requirements or niche adaptations.
Based on homology to well-characterized SEC11 proteins in other organisms, the G. clavigera SEC11 likely contains several conserved domains and motifs essential for its function:
Transmembrane domain: Required for anchoring SEC11 in the endoplasmic reticulum membrane
Catalytic domain with conserved boxes A-E: Contains the critical residues for catalytic activity
Active site residues:
Serine in box B (corresponding to Ser56/68 in human SEC11A/C)
Histidine in box D (corresponding to His96/108 in human SEC11A/C)
Aspartic acid in box E (corresponding to Asp122/134 in human SEC11A/C)
Mutation studies in human SEC11 have shown that altering the catalytic Asp122/134 abolishes enzymatic activity while only moderately affecting protein stability, confirming its critical role in the catalytic mechanism .
While the search results don't specifically mention expression systems for G. clavigera SEC11, commercial suppliers like CUSABIO TECHNOLOGY LLC produce recombinant G. clavigera SEC11 . Based on established protocols for similar proteins, effective expression systems for recombinant G. clavigera SEC11 production likely include:
Bacterial expression systems (E. coli): Suitable for producing the catalytic domain without the transmembrane region, though may require optimization for proper folding of eukaryotic proteins
Yeast expression systems (S. cerevisiae or P. pastoris): Advantage of eukaryotic post-translational machinery, potentially yielding more native-like protein
Insect cell expression systems: May provide better folding environment for complex eukaryotic proteins
For functional studies, heterologous expression in yeast has proven successful for related G. clavigera proteins like GcABC-G1, suggesting this may be a viable approach for SEC11 as well .
While specific purification protocols for G. clavigera SEC11 are not detailed in the search results, effective purification strategies for membrane-associated proteases like SEC11 typically include:
Affinity chromatography: Using tags such as His6, GST, or FLAG for initial capture
Size exclusion chromatography: For separating monomeric SEC11 from aggregates or contaminants
Ion exchange chromatography: For further purification based on charge properties
For membrane proteins like SEC11, additional considerations include:
Use of appropriate detergents to solubilize the protein while maintaining native structure
Careful buffer optimization to preserve activity
Potential reconstitution into liposomes or nanodiscs for functional studies
Quality assessment should include verification of purity by SDS-PAGE, confirmation of identity by mass spectrometry, and validation of enzymatic activity using synthetic peptide substrates containing signal peptide sequences .
To optimize expression conditions for maintaining catalytic activity of recombinant G. clavigera SEC11, researchers should consider:
Expression temperature: Lower temperatures (16-25°C) often improve folding of eukaryotic proteins
Induction parameters: Optimizing inducer concentration and induction time to balance yield and proper folding
Codon optimization: Adapting the G. clavigera SEC11 coding sequence to the codon usage of the expression host
Chaperone co-expression: Including molecular chaperones to assist in proper protein folding
Buffer composition: Including stabilizing agents like glycerol or specific ions required for structural integrity
For functional assays, researchers studying SEC11 in other organisms have used in vitro assays with model substrates like pre-β-lactamase, which could be adapted for G. clavigera SEC11 activity assessment .
While specific assays for G. clavigera SEC11 activity are not detailed in the search results, standard methods for assessing signal peptidase activity that could be adapted include:
In vitro cleavage assays: Using synthetic peptide substrates containing known signal peptide sequences followed by detection of cleavage products by:
HPLC
Mass spectrometry
Fluorescence-based assays with quenched fluorescent peptides
Complementation assays: Testing the ability of G. clavigera SEC11 to rescue growth defects in yeast SEC11 mutants
Cell-free translation systems: Assessing signal peptide cleavage in reconstituted translation systems containing G. clavigera SEC11
For example, studies with human SEC11 paralogs demonstrated that both SPC-A and SPC-C complexes could process pre-β-lactamase in vitro with similar efficiencies, providing a potential model assay system .
To determine the substrate specificity of G. clavigera SEC11, researchers could employ several complementary approaches:
Bioinformatic analysis: Comparing known signal peptide sequences cleaved by SEC11 from other organisms to predict G. clavigera SEC11 substrates
Proteomic approaches:
Analyzing secreted proteins from G. clavigera wild-type and SEC11 mutant strains
Identifying N-terminal peptides to map cleavage sites
Quantitative proteomics to identify proteins affected by SEC11 mutation or inhibition
In vitro cleavage assays: Testing cleavage efficiency of diverse synthetic signal peptides to establish specificity determinants
Structural analysis: Modeling the substrate binding pocket based on homology to characterized SEC11 proteins to predict substrate preferences
These approaches could help identify both conserved substrates shared with other fungi and unique substrates that may contribute to G. clavigera's specialized lifestyle as a pine pathogen.
Several genetic approaches can be employed to study SEC11 function in G. clavigera:
Gene knockout or knockdown:
CRISPR-Cas9 gene editing
RNA interference (RNAi)
Homologous recombination-based gene replacement
Site-directed mutagenesis: Creating specific mutations in catalytic residues (based on the Ser-His-Asp triad identified in other SEC11 proteins) to assess their importance for function
Promoter replacement: Placing SEC11 under control of inducible promoters to study the effects of altered expression levels
Fluorescent protein tagging: Creating SEC11-fluorescent protein fusions to study localization and dynamics
RNA-seq analysis: Comparing transcriptomes of wild-type and SEC11 mutant strains to identify affected pathways
Similar approaches have been successfully used to study other G. clavigera genes, such as the ABC transporter GcABC-G1, where gene knockout increased sensitivity to monoterpenes and delayed symptom development in inoculated pine trees .
While the specific role of SEC11 in G. clavigera pathogenicity has not been directly studied according to the search results, its function as a signal peptidase suggests it likely plays a critical role in processing secreted proteins essential for virulence. Based on our understanding of secretion systems in fungal pathogens:
SEC11 likely processes signal peptides of secreted proteins involved in:
Extracellular enzymes for nutrient acquisition (proteases, lipases, cellulases)
Effector proteins that modulate host defenses
Adhesion proteins required for host colonization
Detoxification enzymes that neutralize host defense compounds
Disruption of SEC11 function would potentially impair the fungus's ability to:
Secrete virulence factors
Acquire nutrients from host tissues
Tolerate host defense compounds
Establish successful infection
By ensuring proper processing of the secretome, SEC11 likely serves as a fundamental enabler of the pathogenic lifestyle of G. clavigera, even if it doesn't directly interact with host components itself.
The signal peptidase complex containing SEC11 likely contributes to this adaptation by ensuring proper processing and secretion of:
Detoxification enzymes that modify terpenoids
Efflux transporters that export toxic compounds
Stress response proteins that protect cellular components
RNA-seq studies have shown that terpenoids induce substantial antimicrobial stress in G. clavigera , and the fungus has developed several mechanisms to cope with the host's monoterpene defense:
A monoterpene efflux system mediated by an ABC transporter (GcABC-G1)
The proper function of these detoxification systems likely depends on correct processing by the secretory pathway, including the signal peptidase complex containing SEC11.
While the search results don't provide information about SEC11 mutations in G. clavigera specifically, insights can be drawn from studies of SEC11 in other organisms and related pathogenicity factors in G. clavigera:
In yeast (S. cerevisiae), SEC11 has been shown to be required for signal peptide cleavage, normal rate of secretion, and cell survival . By extension, mutations in G. clavigera SEC11 would likely:
Disrupt the processing of secreted proteins essential for host colonization
Impair growth and development, potentially reducing virulence
Compromise stress tolerance, including resistance to host defense compounds
For comparison, deletion of the GcABC-G1 transporter gene in G. clavigera:
Increased sensitivity to monoterpenes
Delayed development of symptoms in inoculated young lodgepole pine trees
Prevented the fungus from using (+)-limonene as a carbon source
Similar phenotypic effects might be expected for SEC11 mutations, though likely more severe given the fundamental role of signal peptide processing in secretory pathway function.
SEC11 represents a potential target for antifungal development based on several factors:
Essential function: As a component of the signal peptidase complex, SEC11 likely plays an essential role in fungal viability, similar to its role in yeast
Druggability: The catalytic site containing the Ser-His-Asp triad presents a defined pocket that could be targeted by small molecule inhibitors
Selectivity potential: Differences between fungal and human SEC11 proteins could be exploited to develop selective inhibitors with minimal host toxicity
Potential approaches for targeting SEC11 include:
Structure-based drug design using homology models based on related SEC11 proteins
High-throughput screening of chemical libraries against recombinant G. clavigera SEC11
Peptide-based inhibitors mimicking signal peptide substrates but resistant to cleavage
RNA interference strategies to downregulate SEC11 expression
The development of SEC11 inhibitors could provide new tools for controlling G. clavigera and potentially other pathogenic fungi that rely on secreted virulence factors.
While the search results don't specifically mention techniques used to study G. clavigera SEC11 interactions, several advanced methods could be applied:
Affinity purification coupled with mass spectrometry (AP-MS):
Tagging SEC11 with affinity tags (His, FLAG, etc.)
Purifying SEC11 along with interacting partners
Identifying binding partners by mass spectrometry
Yeast two-hybrid screening:
Using SEC11 as bait to screen G. clavigera cDNA libraries
Identifying direct protein-protein interactions
Proximity-based labeling:
Fusing SEC11 to enzymes like BioID or APEX
Identifying proteins in close proximity through biotinylation
Analyzing labeled proteins by mass spectrometry
Co-immunoprecipitation combined with western blotting:
Using antibodies against SEC11 to pull down protein complexes
Probing for specific interacting proteins
Structural techniques:
Cryo-electron microscopy to visualize the entire signal peptidase complex
X-ray crystallography of SEC11 with binding partners
NMR spectroscopy for studying dynamic interactions
These approaches could reveal how SEC11 interacts with other components of the signal peptidase complex and potentially with regulatory proteins specific to G. clavigera.
Integrative -omics approaches offer powerful ways to study SEC11 function in G. clavigera:
Transcriptomics (RNA-seq):
Comparing gene expression between wild-type and SEC11 mutant strains
Analyzing SEC11 expression under different growth conditions and during host infection
Identifying co-expressed genes that may function in related pathways
Proteomics:
Analyzing the secretome of wild-type vs. SEC11 mutant strains to identify processing defects
Quantitative proteomics to measure protein abundance changes
N-terminal proteomics to map signal peptide cleavage sites
Post-translational modification analysis to identify regulatory mechanisms
Metabolomics:
Measuring changes in metabolite profiles in SEC11 mutants
Identifying metabolic pathways affected by SEC11 dysfunction
Integrative analysis:
Correlating changes across multiple -omics datasets
Network analysis to identify functional modules connected to SEC11
Pathway enrichment analysis to identify biological processes affected by SEC11
Existing RNA-seq datasets for G. clavigera grown under various conditions, including exposure to pine phloem extract, could be mined to understand how SEC11 expression responds to host-derived compounds and stress conditions .
Researchers working with recombinant G. clavigera SEC11 likely encounter several challenges:
Expression challenges:
Low expression levels due to membrane protein nature
Protein misfolding or aggregation
Toxicity to expression host
Improper processing by host signal peptidase
Purification challenges:
Maintaining stability during solubilization from membranes
Selecting appropriate detergents that preserve structure and activity
Separating SEC11 from host cell membrane proteins
Preventing aggregation during concentration
Activity preservation challenges:
Maintaining the native conformation of the catalytic domain
Preserving the catalytic Ser-His-Asp triad integrity
Finding buffer conditions that support enzymatic activity
Stabilizing the protein for long-term storage
To address these challenges, researchers might:
Test multiple expression systems (bacterial, yeast, insect cells)
Optimize expression conditions (temperature, induction timing)
Screen various detergents and buffer conditions
Consider expressing only the catalytic domain without the transmembrane region
Use fusion partners to enhance solubility and folding
When troubleshooting enzymatic activity assays for G. clavigera SEC11, researchers should consider:
Substrate-related issues:
Testing multiple substrate sequences from known G. clavigera secreted proteins
Optimizing substrate concentration to prevent inhibition at high concentrations
Ensuring proper substrate solubility and presentation
Assay condition optimization:
Testing different pH values (typically 7-8 for signal peptidases)
Varying buffer composition (ionic strength, salt type)
Testing different detergents at concentrations below CMC
Screening for cofactor requirements (divalent cations)
Detection method troubleshooting:
For fluorogenic substrates: checking for inner filter effects or quenching
For HPLC/MS methods: optimizing separation conditions and detection parameters
For gel-based assays: ensuring appropriate resolution for cleavage products
Enzyme quality assessment:
Verifying protein purity by SDS-PAGE
Confirming proper folding using circular dichroism
Checking for inhibitory contaminants from the purification process
Comparison with well-characterized signal peptidases from related organisms could provide baseline expectations for activity levels and optimal conditions.
Creating viable SEC11 mutants in G. clavigera may be challenging due to its potentially essential role. Strategies to overcome these difficulties include:
Researchers studying the GcABC-G1 transporter in G. clavigera successfully created gene knockouts using a gene replacement strategy , suggesting that similar approaches could be adapted for SEC11, though with potential modifications if the gene proves essential for viability.
Several promising areas for future investigation of G. clavigera SEC11 function include:
Structural biology:
Determining the three-dimensional structure of G. clavigera SEC11
Comparing its structure with SEC11 from non-pathogenic fungi
Identifying unique structural features that could be exploited for targeted inhibition
Substrate profiling:
Comprehensive identification of proteins processed by SEC11 in G. clavigera
Characterizing signal peptide preferences specific to G. clavigera SEC11
Identifying virulence factors dependent on SEC11 processing
Regulation mechanisms:
Understanding how SEC11 expression and activity are regulated during infection
Investigating post-translational modifications that may modulate SEC11 function
Exploring the relationship between SEC11 and stress response pathways
Host-pathogen interface:
Determining how SEC11-processed proteins interact with host defenses
Investigating the role of SEC11 in adaptation to different pine species
Examining how SEC11 function contributes to the symbiotic relationship with bark beetles
Comparative studies:
Comparing SEC11 function across different ophiostomatoid fungi with varying levels of pathogenicity
Investigating evolutionary adaptations in SEC11 that correlate with host range or virulence
These research directions could provide valuable insights into fundamental aspects of G. clavigera biology and potential intervention strategies.
Emerging technologies that could enhance our understanding of G. clavigera SEC11 include:
Advanced structural biology techniques:
Cryo-electron microscopy for membrane protein complexes
Integrative structural biology combining multiple data sources
AlphaFold2 and other AI-based structure prediction methods
Single-cell technologies:
Single-cell RNA-seq to study SEC11 expression heterogeneity
Single-cell proteomics to analyze protein processing at the individual cell level
Spatial transcriptomics to map SEC11 expression during host colonization
Advanced genome editing:
Prime editing for precise genetic modifications
Base editing for specific nucleotide changes
Inducible CRISPR interference for temporal control of gene expression
Advanced imaging:
Super-resolution microscopy to visualize SEC11 localization
Live-cell imaging with genetically encoded sensors to track SEC11 activity
Correlative light and electron microscopy to connect function with ultrastructure
Systems biology approaches:
Multi-omics integration with machine learning
Genome-scale metabolic modeling to predict effects of SEC11 perturbation
Network analysis to position SEC11 in the context of cellular pathways
These technologies could provide unprecedented insights into SEC11 function in G. clavigera and its role in pathogenicity.
Research on G. clavigera SEC11 has several important implications for understanding other pathogenic fungi:
Comparative fungal pathogenicity mechanisms:
Insights into how secreted proteins contribute to virulence in tree pathogens
Understanding common adaptations in fungi that overcome plant defenses
Identifying conserved vs. specialized roles of the secretory pathway in pathogenesis
Evolutionary insights:
Understanding how signal peptidase systems adapt to different hosts
Tracking evolutionary changes in SEC11 across fungal lineages with different lifestyles
Identifying selection pressures on secretory pathways in pathogens
Broad-spectrum antifungal development:
Assessing SEC11 as a potential target across multiple pathogenic fungi
Identifying conserved features of fungal SEC11 distinct from mammalian counterparts
Developing inhibitors that could work against multiple plant pathogens
Biotechnological applications:
Improving heterologous protein secretion in fungi
Engineering signal peptidase systems for biotechnological applications
Developing fungal expression systems with modified secretory capabilities
Ecological understanding:
Insights into how secretory pathways contribute to fungal adaptation to diverse niches
Understanding the role of secreted proteins in complex symbioses involving insects and plants
Predicting how fungi might adapt to new hosts or environmental conditions