Recombinant Guanarito virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice and additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
246-479
Protein Length
Full Length of Mature Protein
Species
Guanarito mammarenavirus (isolate Human/Venezuela/NH-95551/1990) (GTOV)
Target Names
GPC
Target Protein Sequence
AFFSWSLSDPKGNDMPGGYCLERWMLVAGDLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN KNAIEKLNNQTKTAVNMLTHSINSLISDNLLMRNKLKEILKVPYCNYTRFWYINHTKSGE HSLPRCWLVSNGSYLNESDFRNEWILESDHLIAEMLSKEYQDRQGKTPLTLVDLCFWSAI FFTTSLFLHLVGFPTHRHIQGDPCPLPHRLDRNGACRCGRFQKLGKQVTWKRKH
Uniprot No.

Target Background

Function

This recombinant Guanarito virus Pre-glycoprotein polyprotein GP complex (GPC) interacts with the host receptor, mediating viral attachment to host transferrin receptor (TFRC). This interaction primarily triggers virion internalization via clathrin-mediated endocytosis. The GPC acts as a class I viral fusion protein, directing fusion between viral and host endosomal membranes, thereby delivering the nucleocapsid into the cytoplasm. This membrane fusion results from irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) component is cleaved, functioning as a signal peptide while also remaining as part of the GP complex. The SSP is essential for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion.

Database Links

KEGG: vg:2943169

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the Guanarito virus glycoprotein complex?

The Guanarito virus (GTOV) pre-glycoprotein polyprotein (GPC) follows the typical arenavirus organization. After synthesis, cellular signal peptidase cleaves GPC into a stable signal peptide (SSP) and GP1/GP2 precursor. This precursor is further processed by the cellular subtilase SKI-1/S1P into distinct GP1 and GP2 subunits . The GP1 subunit is located at the N-terminal portion and is responsible for receptor binding, specifically to human transferrin receptor 1 (hTfR1) . The GP2 subunit contains a transmembrane domain (TMD) and cytoplasmic tail (CT) at the C-terminal end, which mediate fusion of viral and host cell membranes after virus particles are internalized into acidified endosomes . Crystal structure analysis at 4.1-Å resolution has revealed that GP2 forms a classical six-helix bundle structure, confirming that New World arenaviruses like GTOV utilize class I viral membrane fusion machinery .

What role do N-linked glycans play in the GPC structure and function?

N-linked glycans contribute significantly to the structure and function of GTOV GPC, accounting for approximately 40% of the mass of recombinant GTOV GP2 . These glycans serve multiple critical functions:

  • Protein folding and maturation: N-linked glycosylation motifs are essential for proper expression, folding, and cleavage of GPC .

  • Immune evasion: Specific glycans on arenavirus GPCs mask important epitopes, helping the virus evade neutralizing antibody responses .

  • Virulence determination: Studies have shown that acquisition of N-linked glycans at specific positions (such as N83 and N166) enhances virus virulence in animal models .

  • Glycocalyx formation: The N-linked glycans form an extensive glycocalyx coat that provides significant coverage of the underlying protein surface following virus-host membrane fusion .

The glycosylation sites are differentially occupied when recombinantly expressed, suggesting that most individual sites are dispensable for folding, though collectively they significantly impact viral function and pathogenicity .

How do GTOV glycoproteins mediate viral entry into host cells?

GTOV entry into host cells follows a multi-step process that requires coordinated functions of both glycoprotein subunits:

  • Receptor binding: The GP1 subunit binds with high affinity to transferrin receptor 1 (TfR1) on the surface of host cells . This interaction is specific for New World arenaviruses including GTOV.

  • Endocytosis: Following receptor binding, the virus is internalized via clathrin-mediated endocytosis .

  • pH-dependent conformational changes: Upon acidification in the endosomal compartment, GP1 is released from the virion .

  • Membrane fusion: The GP2 subunit undergoes significant conformational rearrangements, exposing a hydrophobic fusion peptide that inserts into the host cell membrane. This is followed by the formation of a six-helix bundle structure that brings the viral and cellular membranes into close proximity, facilitating fusion .

This process is characteristic of class I viral fusion mechanisms, which has been directly confirmed by crystallographic studies of GTOV GP2 .

How do specific glycosylation patterns on GTOV GPC affect antibody neutralization and viral pathogenicity?

Glycosylation patterns on GTOV GPC significantly impact both antibody neutralization and viral pathogenicity. Research using animal models has revealed several key insights:

  • Glycan acquisition and virulence: Studies with Machupo virus (MACV) chimeric constructs containing GTOV-like elements showed that mutations resulting in acquisition of N-linked glycans at positions N83 and N166 occurred frequently in late stages of infection. These mutations represented phenotypic reversion to gain glycans critical for infection in vivo .

  • Antibody escape: GPC mutant viruses with additional glycans demonstrated increased resistance to neutralizing antibodies. Plaque reduction neutralization tests (PRNT) confirmed that viruses acquiring glycans at N83 and N166 were more resistant to antibody neutralization, presumably because these glycans mask important epitopes involved in virus entry .

  • Virulence enhancement: Glycan acquisition correlated with increased virulence in animal models. When tested in vivo, isolates with additional glycosylation sites showed enhanced virulence compared to their parental strains .

  • Immunogenic potential: Interestingly, MACV virus mutants lacking specific glycans on GPC elicited higher levels of neutralizing antibodies against wild-type MACV, suggesting these glycans impact GPC immunogenicity in complex ways that could be exploited for vaccine development .

These findings demonstrate that specific N-linked glycans serve as a critical virulence determinant by modulating both immune evasion capabilities and intrinsic viral pathogenicity.

What methodological approaches can be used to study glycan shielding effects on antibody neutralization?

Investigating glycan shielding effects on antibody neutralization requires multi-faceted methodological approaches:

  • Generation of glycosylation site mutants: Site-directed mutagenesis to create recombinant viruses with specific glycosylation sites either added or removed. This typically involves introducing or disrupting N-X-S/T motifs within the GPC sequence .

  • Plaque reduction neutralization tests (PRNT): These assays quantitatively measure the ability of antibodies to neutralize viral infectivity by determining the serum dilution that reduces plaque formation by a specific percentage (typically 50% or 80%). Comparing PRNT50 or PRNT80 values between wild-type and glycan-modified viruses provides direct evidence of glycan shielding effects .

  • Western blotting analysis: To confirm altered glycosylation patterns, Western blotting can detect changes in molecular weight of viral glycoproteins. Differential migration patterns can confirm the presence or absence of glycans at specific sites .

  • Crystallographic studies: Structural determination of glycosylated proteins through X-ray crystallography, as performed with GTOV GP2 to 4.1-Å resolution, provides direct visualization of the glycan shield. Expression in GlcNAc transferase I-deficient cells can help generate more homogeneous glycoforms suitable for crystallization .

  • Glycan dynamics modeling: Consideration of glycan dynamics beyond static crystal structures reveals how flexible glycan structures provide extensive coverage of underlying protein surfaces .

  • Animal infection models: Testing glycan mutant viruses in suitable animal models (like IFN-αβ/γ R-/- mice for MACV) provides in vivo validation of glycan shielding effects on pathogenicity and antibody escape .

These complementary approaches provide comprehensive insights into how specific glycans influence antibody recognition and neutralization.

What are the challenges and methodological considerations when developing a reverse genetics system for Guanarito virus?

Developing a reverse genetics system for Guanarito virus presents several challenges and considerations that researchers must address:

  • Biosafety requirements: GTOV is classified as a Category A bioterrorism agent requiring BSL-4 containment facilities, which significantly limits research access and increases operational complexity .

  • Cytopathic effect optimization: Wild-type GTOV typically produces unclear cytopathic effects (CPE) in Vero cells, complicating virus detection and quantification. Adaptation through serial passage to generate variants with clear CPE, such as the E1497K mutation in the L protein, can facilitate reverse genetics system development .

  • Plasmid construction: Systems typically require construction of plasmids containing full-length L and S genomic segments under the control of appropriate promoters. For GTOV, this resulted in plasmids designated pRF-GTOV-SRG and pRF-GTOV-LRG .

  • Transfection efficiency: Optimizing transfection protocols for delivery of rescue plasmids into appropriate cell lines (typically Vero or BHK cells for arenaviruses) is critical for successful rescue .

  • Verification methods: Comparing viral growth kinetics between wild-type and recombinant viruses is essential to confirm that the rescued recombinant virus faithfully represents the natural virus. Plaque size, morphology, and growth curves should be analyzed .

  • Mutation analysis: Strategic introduction of specific mutations followed by phenotypic characterization is necessary to identify determinants of viral properties. For example, researchers identified that the E1497K substitution in the L protein enhanced viral RNA replication and transcription efficiency in GTOV .

  • Long-term stability: Ensuring genetic stability of the recombinant viruses over multiple passages is essential for meaningful experimental results.

The successful development of such systems significantly accelerates vaccine and antiviral drug development efforts against these highly pathogenic viruses .

What expression systems are optimal for producing recombinant GTOV GPC for structural studies?

Several expression systems have been used for producing recombinant GTOV GPC, each with specific advantages for structural studies:

  • Mammalian expression systems:

    • HEK 293S GnTI- cells: These GlcNAc transferase I-deficient human embryonic kidney cells trap glycosylation predominantly to a homogenous Man5GlcNAc2 glycoform, which significantly enhances protein homogeneity for crystallization .

    • Expression vectors: Vectors like pOPINTTGNeo have been successfully used for mammalian expression of GTOV GP2 .

    • Purification strategy: Immobilized metal affinity chromatography followed by size exclusion chromatography has been effective for purifying recombinant GTOV GP2 .

  • Crystallization approaches:

    • For GTOV GP2, successful crystallization was achieved using sitting-drop vapor diffusion with 0.15 M Li2SO4, 0.1 M citric acid, pH 3.5, 18% (wt/vol) polyethylene glycol 6000 equilibrated at 22°C .

    • Cryoprotection with 25% ethylene glycol before cooling to 100 K has proven effective for X-ray diffraction data collection .

  • Construct design considerations:

    • Removal of aggregation-prone regions: For successful crystallization of GTOV GP2, approximately 50 residues at the N-terminus were removed to exclude the aggregation-inducing N-terminal hydrophobic fusion loop .

    • Truncation strategies: Strategic domain boundaries based on secondary structure predictions enhance expression and crystallization success.

  • Expression verification:

    • SDS-PAGE analysis can reveal differential occupancy of N-linked glycosylation sites, appearing as multiple bands separated by approximately 2 kDa increments .

These methodological approaches have enabled successful structural determination of GTOV GP2 to 4.1-Å resolution, providing crucial insights into its fusion mechanism .

How can researchers generate and characterize GTOV GPC glycosylation mutants?

Generating and characterizing GTOV GPC glycosylation mutants requires a systematic approach:

  • Mutant design and construction:

    • Site-directed mutagenesis to either introduce or disrupt N-linked glycosylation sequons (N-X-S/T) .

    • For introducing glycosylation sites, mutations like P85S and A168S/T have been shown to create new N-X-S/T motifs at positions N83 and N166 .

    • For disrupting glycosylation, substitution of asparagine (N) with glutamine (Q) or other amino acids maintains similar structural properties while preventing glycosylation.

  • Reverse genetics for virus rescue:

    • Transfection of mutated plasmids into appropriate cell lines to rescue recombinant viruses .

    • Plaque purification to isolate homogeneous virus populations, typically requiring two successive rounds .

  • Verification of glycosylation status:

    • Western blotting to detect mobility shifts in GPC or GP2 migration patterns. Successfully glycosylated proteins typically migrate more slowly on SDS-PAGE .

    • Enzymatic deglycosylation using PNGase F or Endo H to confirm that mobility shifts are indeed due to glycosylation.

    • Mass spectrometry can provide definitive identification of glycan structures and site occupancy.

  • Functional characterization:

    • Growth kinetics in different cell types to assess replication efficiency .

    • Plaque size and morphology analysis to evaluate cytopathic effects .

    • Antibody neutralization assays (PRNT) to determine changes in susceptibility to neutralizing antibodies .

    • Animal infection models to assess changes in virulence .

  • Stability assessment:

    • Sequential passage of mutant viruses to determine genetic stability of introduced mutations .

    • Sequencing of viral populations after multiple passages or from infected animals to identify potential reversion or compensatory mutations .

This methodological framework has successfully revealed the critical importance of specific glycans on GPC in arenavirus pathogenicity and antibody escape .

What are the key structural features of GTOV GP2 that facilitate membrane fusion?

The crystal structure of GTOV GP2 reveals several key features that facilitate membrane fusion, characteristic of class I viral fusion proteins:

  • Six-helix bundle (6HB) architecture:

    • GTOV GP2 forms a classical six-helix bundle in its postfusion conformation .

    • This structure consists of a central triple-stranded coiled coil surrounded by three antiparallel helices .

    • The 6HB formation provides the energy necessary to bring viral and cellular membranes into close proximity for fusion.

  • N-terminal fusion peptide:

    • Although excluded from the crystallized construct for technical reasons, GTOV GP2 contains a bipartite fusion peptide at its N-terminus that inserts into target host membranes .

    • This hydrophobic peptide initiates the fusion process by destabilizing the host membrane.

  • Extended conformational states:

    • GP2 undergoes dramatic conformational changes from a metastable prefusion state to a stable postfusion state during the fusion process.

    • These changes are triggered by acidification in the endosomal environment .

  • Glycan shield:

    • The structure reveals a comprehensive N-linked glycocalyx coat surrounding the protein core .

    • Consideration of glycan dynamics shows extensive coverage of the underlying protein surface, which may provide protection from immune recognition while still allowing necessary conformational changes .

  • Transmembrane domain:

    • While not present in the crystallized construct, the C-terminal transmembrane domain anchors GP2 to the viral membrane and plays a critical role in the fusion process .

These structural features collectively enable the coordinated process of membrane fusion that allows viral entry into target cells, making them potential targets for antiviral development .

How do N-linked glycans on GTOV GPC influence the viral life cycle beyond immune evasion?

N-linked glycans on GTOV GPC play multifaceted roles throughout the viral life cycle beyond immune evasion:

These diverse functions highlight the integral role of N-linked glycans as structural and functional components of GTOV GPC throughout multiple stages of the viral life cycle .

What strategies can enhance the immunogenicity of GTOV GPC-based vaccine candidates?

Developing effective GTOV GPC-based vaccine candidates requires strategic approaches to enhance immunogenicity:

  • Glycan modification strategies:

    • Selective removal of glycans that mask key neutralizing epitopes: Research has shown that MACV lacking specific GPC glycans elicited higher levels of neutralizing antibodies against wild-type virus .

    • Targeted glycan engineering to optimize the balance between protein stability and epitope exposure.

  • Chimeric glycoprotein constructs:

    • Creating chimeric GPCs that combine immunogenic regions from different arenavirus strains, as demonstrated by studies with MACV and Junin virus Candid#1 vaccine strain .

    • These chimeras can present critical epitopes in more immunogenic contexts.

  • Recombinant virus platforms:

    • Reverse genetics systems, like those developed for GTOV, enable the generation of attenuated viruses with specific mutations .

    • Mutations in viral polymerase (L protein), such as E1497K, that enhance viral replication in cell culture without increasing pathogenicity could improve vaccine manufacturing yields .

  • Multi-epitope vaccine design:

    • Identification and inclusion of multiple neutralizing epitopes from GP1 and GP2.

    • Focusing on conserved epitopes among pathogenic arenaviruses to potentially create broadly protective vaccines.

  • Adjuvant selection:

    • Pairing GPC antigens with adjuvants that specifically enhance Th1-type responses and neutralizing antibody production.

    • Considering toll-like receptor (TLR) agonists that have shown promise with other hemorrhagic fever virus vaccines.

  • Delivery platform optimization:

    • DNA vaccines encoding optimized GPC sequences.

    • mRNA-based delivery systems that have demonstrated success with other viral glycoproteins.

    • Viral vector platforms (VSV, adenovirus) expressing GTOV GPC with optimized immunogenicity.

These approaches recognize the critical balance between maintaining appropriate protein folding and enhancing exposure of neutralizing epitopes that are typically shielded by glycans in wild-type viruses .

What are the key considerations for evaluating the protective efficacy of GTOV GPC-based vaccines?

Evaluating the protective efficacy of GTOV GPC-based vaccines involves several critical considerations:

  • Neutralizing antibody responses:

    • Measurement of neutralizing antibody titers using plaque reduction neutralization tests (PRNT) .

    • Evaluation of antibody affinity and avidity to GPC epitopes.

    • Assessment of antibody persistence over time to determine durability of protection.

    • Cross-neutralization testing against diverse GTOV strains and potentially other New World arenaviruses.

  • Animal model selection:

    • IFN-αβ/γ R-/- mice have been used successfully for MACV studies and may be applicable for GTOV .

    • Guinea pig models may better recapitulate human disease for arenavirus infections.

    • Non-human primate models provide the most relevant pre-clinical assessment but come with significant ethical and resource considerations.

  • Challenge studies:

    • Determination of appropriate challenge dose and route to mimic natural infection.

    • Monitoring of viral loads in blood and tissues following challenge.

    • Assessment of clinical signs, including hemorrhagic manifestations, to evaluate disease protection.

  • Cell-mediated immune responses:

    • Evaluation of T-cell responses to GPC, including CD4+ and CD8+ T-cell activation.

    • Cytokine profiling to characterize Th1/Th2 balance of immune response.

    • Assessment of memory T-cell formation for long-term protection.

  • Safety assessment:

    • Monitoring for enhanced disease or antibody-dependent enhancement phenomena.

    • Evaluation of potential autoimmune reactions, particularly given GPC binding to transferrin receptor.

    • Histopathological examination of tissues for vaccine-induced pathology.

  • Genetic stability:

    • Sequencing of GPC from breakthrough infections to identify potential escape mutations.

    • Monitoring for reversion of attenuating mutations in live-attenuated vaccine candidates.

    • Assessment of genetic stability across multiple passages of vaccine strains.

  • Correlates of protection:

    • Identification of specific antibody titers or cellular responses that correlate with protection.

    • Development of assays to measure these correlates for future clinical trials.

These multifaceted evaluation approaches are essential for comprehensive assessment of GTOV GPC-based vaccine candidates before advancing to human clinical trials .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.