Recombinant Guillardia theta Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Guillardia theta Apocytochrome f (petA)

Apocytochrome f is a critical component of the cytochrome $$b_6f$$ complex, essential for photosynthetic electron transfer in plants and algae . In Guillardia theta, a cryptophyte alga, the apocytochrome f is encoded by the petA gene located in the chloroplast genome . Recombinant Guillardia theta apocytochrome f (petA) refers to the protein produced using recombinant DNA technology, where the petA gene from Guillardia theta is expressed in a host organism to produce large quantities of the apocytochrome f protein .

Biosynthesis and Maturation of Cytochrome f

The biosynthesis of cytochrome f is a multi-step process . It begins with the translation of the petA mRNA into a precursor apocytochrome f protein . This precursor contains a signal peptide that directs the protein to the thylakoid lumen, the site of cytochrome $$b_6f$$ complex assembly .

Steps in Cytochrome f Maturation:

  1. Translocation: The precursor protein is translocated across the thylakoid membrane .

  2. Signal Peptide Cleavage: The signal peptide is cleaved off by a thylakoid processing peptidase, resulting in apocytochrome f .

  3. Heme Attachment: A heme group is covalently attached to the apocytochrome f, converting it into holocytochrome f . This step is essential for the protein's function in electron transfer.

Role of Apocytochrome f in Photosynthesis

Apocytochrome f is a subunit of the cytochrome $$b_6f$$ complex, which mediates electron transfer between Photosystem II and Photosystem I in the photosynthetic electron transport chain . The cytochrome $$b_6f$$ complex oxidizes plastoquinol (PQH2PQH_2) and reduces plastocyanin, contributing to the proton gradient across the thylakoid membrane that drives ATP synthesis .

Importance of Recombinant Production

Recombinant production of Guillardia theta apocytochrome f (petA) is valuable for several reasons:

  • Structural Studies: Allows for the production of sufficient quantities of the protein for structural analysis, such as X-ray crystallography, to understand its structure-function relationship .

  • Biochemical Studies: Facilitates detailed biochemical studies to elucidate the mechanism of electron transfer and the interaction of cytochrome f with other components of the cytochrome $$b_6f$$ complex .

  • Biotechnological Applications: Recombinant cytochrome f can be used in biotechnological applications, such as the development of artificial photosynthetic systems or biosensors .

Factors Affecting Cytochrome f Accumulation

Several factors influence the synthesis and accumulation of cytochrome f:

  • Translation Efficiency: The 5' untranslated region (UTR) of the petA mRNA plays a crucial role in regulating translation efficiency .

  • Assembly Factors: Assembly factors, such as CCS5, are required for heme attachment and proper assembly of cytochrome f into the cytochrome $$b_6f$$ complex .

  • Protein Stability: The stability of apocytochrome f is influenced by its ability to bind heme and assemble into the cytochrome $$b_6f$$ complex . Mutations that prevent heme binding can lead to increased degradation of the protein .

Potential Applications

Further research into Recombinant Guillardia theta Apocytochrome f (petA) could lead to advancements in:

  • Understanding Photosynthesis: Detailed studies of the structure, function, and assembly of cytochrome f can provide valuable insights into the fundamental mechanisms of photosynthesis.

  • Improving Crop Yields: Modifying the expression or stability of cytochrome f in plants could enhance photosynthetic efficiency and increase crop yields.

  • Developing Sustainable Energy Technologies: Recombinant cytochrome f could be used in the development of artificial photosynthetic systems for sustainable energy production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-321
Protein Length
Full Length of Mature Protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
petA
Target Protein Sequence
FPVFAQQAYENPREATGRIVCANCHLAQKPVEIEVPQAVLPDTVFEAVVEVPYDLSLQQV TGNGTKGPLNVGAVVILPEGFTLAPKDRISSELKEKTKGLIITPYNEANPNILVVGPVPG KDHQKLVFPVLSPNPAENKNVHFIKYPVYVGANRGRGQVNPTGEKSNNTVYTSPIDGQIV KLEKSDNVTSFSIKSKTGDIITVKVPFGPDILVKEGQTLVADQQLTNDPNVGGFGQVETE IVLQSPARVKGLIAFFFTVILAQILLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant Guillardia theta Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Guillardia theta Apocytochrome f and why is it significant for research?

Guillardia theta Apocytochrome f is the protein precursor (before heme attachment) encoded by the nuclear petA gene in the cryptophyte alga Guillardia theta. Its significance stems from its unique evolutionary history, as it represents a case of gene transfer from the chloroplast to the nucleus during endosymbiotic events. Unlike most photosynthetic organisms where cytochrome f is encoded by the chloroplast genome, in cryptophytes like G. theta, this gene has been relocated to the nuclear genome .

The protein contains distinctive features including a tripartite chloroplast transit peptide (CTP) that facilitates its transport through the three membranes surrounding the cryptophyte chloroplast. This makes it an excellent model for studying protein targeting and organelle evolution in complex algal systems .

How does the gene structure of nuclear-encoded petA in G. theta differ from chloroplast-encoded versions?

The nuclear-encoded petA gene in G. theta exhibits several distinct characteristics compared to its chloroplast-encoded counterparts in other organisms:

  • The gene displays typical nuclear codon usage patterns rather than chloroplast codon bias .

  • It contains introns, which are rare or absent in chloroplast genes.

  • It includes additional sequences encoding a transit peptide for chloroplast targeting.

  • Based on similar studies in other organisms, the gene likely has acquired regulatory elements typical of nuclear genes.

The acquisition of nuclear regulatory elements allows for more sophisticated control of expression compared to chloroplast genes, potentially enabling G. theta to fine-tune cytochrome f production in response to various environmental conditions .

What evolutionary insights can be gained from studying G. theta Apocytochrome f?

Studying G. theta Apocytochrome f provides valuable insights into the evolutionary processes of endosymbiosis and organelle development:

  • It illustrates the ongoing process of endosymbiotic gene transfer (EGT) from organelles to the nucleus, a critical aspect of eukaryotic evolution.

  • It demonstrates how proteins can be repurposed and acquire new targeting signals during evolution.

  • The complex targeting sequence reveals mechanisms of protein import through multiple membranes, reflecting the cryptophyte's complex plastid evolution.

  • Comparative analysis with other algae reveals evolutionary mosaicism, where genes of different origins contribute to the same cellular compartments and metabolic pathways .

Research on G. theta Apocytochrome f contributes to our understanding of how eukaryotic cells integrate genetic material from endosymbionts and develop new protein targeting mechanisms during evolution.

What challenges exist in expressing recombinant G. theta Apocytochrome f in heterologous systems?

Expression of recombinant G. theta Apocytochrome f presents several significant challenges:

  • Complex targeting sequence handling: The tripartite chloroplast transit peptide may cause improper folding or aggregation in heterologous systems that lack the appropriate processing machinery .

  • Post-translational modifications: Proper heme attachment to convert apocytochrome to functional cytochrome requires specific enzymatic machinery that may be absent in common expression systems.

  • Codon optimization requirements: The nuclear codon usage of G. theta differs from common expression hosts, potentially necessitating codon optimization for efficient expression.

  • Protein solubility issues: Like other membrane-associated proteins, cytochrome f may present solubility challenges when expressed recombinantly.

  • Proper folding environment: The unique structural features of G. theta cytochrome f, including any lineage-specific insertions (similar to the 62-residue insertion seen in E. gracilis cytochrome f), may require specialized chaperones for proper folding .

Methodological approaches to address these challenges include using eukaryotic expression systems with organelles (such as yeast or algal systems), employing fusion tags to enhance solubility, and developing custom purification protocols that maintain protein integrity.

How do the targeting mechanisms of G. theta Apocytochrome f function across the three-membrane chloroplast envelope?

The targeting of G. theta Apocytochrome f involves sophisticated mechanisms to traverse the three membranes surrounding the cryptophyte chloroplast:

  • Initial ER targeting: The N-terminal signal peptide directs the nascent protein to the endoplasmic reticulum.

  • Transit peptide function: Following the signal peptide is a chloroplast transit peptide that guides the protein across the second and third membranes of the chloroplast envelope.

  • Lumenal targeting domain: For proteins destined for the thylakoid lumen (like cytochrome f), a third domain containing a twin-arginine motif (TAT pathway signal) facilitates crossing the thylakoid membrane .

Research approaches to study this mechanism include:

  • Creating fluorescent fusion proteins with various segments of the targeting sequence to track localization

  • Developing in vitro import assays with isolated organelles

  • Performing site-directed mutagenesis of key residues in each targeting domain to assess their importance

The complete targeting process demonstrates remarkable evolutionary innovation, allowing nuclear-encoded proteins to replace their chloroplast-encoded predecessors while maintaining proper localization .

What structural adaptations has G. theta Apocytochrome f acquired compared to its algal relatives?

Based on comparative studies of cytochrome f proteins in algae, G. theta Apocytochrome f likely contains unique structural adaptations:

  • Lineage-specific insertions: Similar to E. gracilis cytochrome f, which contains a unique 62-residue insertion, G. theta may have developed specific insertions or extensions that modify its structure and function .

  • Modified interaction domains: As part of the cytochrome b6f complex, G. theta cytochrome f likely contains adapted surfaces for interaction with other complex components, particularly those that have also undergone evolutionary changes.

  • Altered heme environment: The protein might display modifications in the residues surrounding the heme group, potentially affecting its redox properties.

  • Association domains: The protein may contain specialized domains for association with the thylakoid membrane and proper positioning within the photosynthetic electron transport chain.

Approaches to study these structural adaptations include X-ray crystallography, cryo-electron microscopy of the assembled cytochrome b6f complex, and comparative molecular modeling based on cytochrome f structures from other organisms.

What expression systems are most suitable for producing recombinant G. theta Apocytochrome f?

Selection of an appropriate expression system is critical for successful production of functional recombinant G. theta Apocytochrome f:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, ease of use, rapid growthLimited post-translational modifications, poor folding of complex proteinsInitial structural studies, antibody production
Yeast (P. pastoris, S. cerevisiae)Eukaryotic folding machinery, moderate yield, secretion capacityMay not process complex targeting sequences properlyFunctional studies requiring proper folding
Insect cellsAdvanced eukaryotic folding, good for membrane proteinsHigher cost, longer production timeStructural biology, protein-protein interaction studies
Algal systemsNative-like folding environment, appropriate post-translational modificationsLower yield, more complex protocolsFunctional studies requiring authentic protein

Methodological considerations include:

  • For E. coli expression, consider using specialized strains like Rosetta (for rare codons) or SHuffle (for disulfide bond formation).

  • When using yeast systems, optimize codon usage and consider using strong inducible promoters like AOX1 (P. pastoris).

  • For algal expression, closely related species with established transformation protocols may provide the most authentic environment for proper folding and assembly.

The choice should be guided by the specific research questions and the properties of the protein required for downstream applications .

What purification strategies yield the highest quality recombinant G. theta Apocytochrome f?

Purification of recombinant G. theta Apocytochrome f requires a carefully designed strategy:

  • Initial extraction considerations:

    • For membrane-associated forms, use mild detergents like n-Dodecyl β-D-maltoside (DDM) or digitonin

    • Buffer composition should maintain protein stability (typically pH 7.0-8.0 with stabilizing agents)

  • Multi-step purification protocol:

    • Affinity chromatography using engineered tags (His-tag, Strep-tag) as the initial capture step

    • Ion-exchange chromatography to separate based on charge properties

    • Size-exclusion chromatography as a polishing step and to confirm proper oligomeric state

  • Quality control assessment:

    • Spectroscopic analysis to confirm proper heme incorporation (if using holocytochrome)

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to evaluate stability

    • Activity assays to confirm electron transfer capability

For structural studies, additional considerations include removing flexible regions (like the transit peptide) and optimizing buffer conditions to improve protein homogeneity and stability. Protein purity should be assessed using multiple methods including SDS-PAGE, western blotting, and mass spectrometry .

How can researchers investigate the functional domains of G. theta Apocytochrome f?

Investigating functional domains requires a systematic approach combining computational and experimental methods:

  • Initial domain identification:

    • Conduct sequence alignments with cytochrome f from diverse organisms

    • Use computational tools to predict conserved and variable regions

    • Identify potential functional motifs such as heme-binding sites and membrane-anchoring domains

  • Experimental validation methods:

    • Generate a series of truncation constructs to remove specific domains

    • Create point mutations in conserved residues within each domain

    • Develop domain-swapping chimeras with cytochrome f from other organisms

  • Functional assessment techniques:

    • Electron transfer activity assays using artificial electron donors/acceptors

    • Protein-protein interaction studies using pull-down assays or surface plasmon resonance

    • In vivo complementation in cytochrome f-deficient mutants

    • Structural studies of isolated domains using NMR or X-ray crystallography

  • Data integration:

    • Correlate structural information with functional outcomes

    • Map conservation patterns to functional importance

    • Build predictive models of structure-function relationships

This systematic approach can reveal how specific domains contribute to protein targeting, assembly into the cytochrome b6f complex, and electron transfer function .

How can researchers overcome expression problems with recombinant G. theta Apocytochrome f?

When facing expression challenges with recombinant G. theta Apocytochrome f, consider these methodological solutions:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Use specialized expression strains with additional tRNAs for rare codons

    • Consider adding introns to improve mRNA stability in eukaryotic systems

  • Protein insolubility:

    • Express at lower temperatures (16-20°C) to slow folding

    • Co-express with molecular chaperones

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Test different cell lysis and extraction conditions

    • Express as fragments if full-length protein proves consistently problematic

  • Improper folding:

    • Include appropriate cofactors in the growth medium

    • Add specific chaperones that assist cytochrome folding

    • Consider native-like membrane mimetics for stabilization

    • Use periplasmic targeting in E. coli to provide a more oxidizing environment

  • Degradation issues:

    • Add protease inhibitors throughout purification

    • Use protease-deficient expression strains

    • Optimize buffer conditions to enhance stability

    • Remove recognition sites for common proteases through site-directed mutagenesis

These approaches should be tested systematically, documenting conditions and outcomes to identify the most effective combination for your specific construct .

What are the critical quality control parameters for assessing recombinant G. theta Apocytochrome f?

Rigorous quality control is essential for ensuring that recombinant G. theta Apocytochrome f is suitable for downstream applications:

Assessment ParameterMethodKey IndicatorsAcceptance Criteria
PuritySDS-PAGE, Size Exclusion ChromatographySingle band/peak, lack of contaminants>95% purity
IdentityMass Spectrometry, Western BlotMass matching prediction, antibody recognitionMass within 0.1% of theoretical, positive WB signal
Secondary StructureCircular DichroismAlpha-helical content consistent with cytochrome fPattern matching reference spectrum
Heme IncorporationUV-Vis SpectroscopyCharacteristic absorbance peaksSoret band at ~410nm, α/β bands in visible region
HomogeneityDynamic Light ScatteringMonodispersity, appropriate hydrodynamic radiusPolydispersity index <0.2
Functional ActivityElectron Transfer AssaysAbility to accept/donate electronsActivity comparable to native protein
Thermal StabilityDifferential Scanning FluorimetryMelting temperature (Tm)Consistent Tm between batches

For structural biology applications, additional criteria such as behavior in concentration tests, stability over time, and performance in crystallization trials should be assessed. Document all quality parameters in a standardized format to ensure reproducibility between preparations .

How should researchers approach contradictory results when studying G. theta Apocytochrome f function?

When facing contradictory results in G. theta Apocytochrome f research, follow this systematic approach:

  • Validate experimental systems:

    • Confirm protein identity using orthogonal methods (mass spectrometry, western blotting)

    • Verify expression construct sequences to rule out mutations

    • Assess protein quality metrics (purity, folding, stability) across different preparations

  • Evaluate methodological differences:

    • Compare experimental conditions in detail (buffer composition, pH, temperature, salt concentration)

    • Assess the impact of different expression systems on protein properties

    • Consider whether the presence/absence of fusion tags affects results

  • Reconcile contradictions through targeted experiments:

    • Design experiments specifically addressing the contradiction

    • Test multiple independent approaches to measure the same parameter

    • Systematically vary conditions to identify factors causing divergent results

  • Consider biological explanations:

    • Investigate whether G. theta Apocytochrome f exhibits context-dependent behavior

    • Examine if protein modifications or conformational states could explain differences

    • Assess whether interaction partners present in some systems but not others affect function

  • Collaborative verification:

    • Share materials with collaborators to test in different laboratory environments

    • Develop standardized protocols to minimize technical variability

    • Consider blind testing to eliminate unconscious bias

How can G. theta Apocytochrome f research inform synthetic biology applications?

Research on G. theta Apocytochrome f offers several valuable insights for synthetic biology applications:

  • Engineering multi-membrane protein targeting systems:

    • The tripartite targeting sequence provides a template for designing synthetic proteins that can traverse multiple membranes

    • This capability could enable new approaches for delivering proteins to specific organelles or creating artificial organelles

    • The targeting mechanism could inspire design of synthetic protein localization systems in artificial cells

  • Photosynthetic system engineering:

    • Understanding the unique adaptations in G. theta cytochrome f could inform efforts to enhance or modify photosynthetic electron transport in crop plants or synthetic systems

    • The protein's role in the cytochrome b6f complex makes it a potential target for engineering improved photosynthetic efficiency

  • Evolutionary design principles:

    • The natural evolutionary process that relocated petA to the nucleus demonstrates successful "refactoring" of a critical cellular system

    • This provides a model for how synthetic biologists might redesign and relocate essential genes within engineered organisms

  • Biomimetic materials development:

    • Structural features of cytochrome f could inspire design of novel electron-conducting biomaterials

    • The protein's specificity in electron transfer could inform development of selective catalysts

These applications represent areas where fundamental research on G. theta Apocytochrome f extends beyond basic science into potential biotechnological innovations .

What are the most promising research directions for understanding G. theta Apocytochrome f regulation?

Future research on G. theta Apocytochrome f regulation should focus on these promising directions:

  • Transcriptional regulation mechanisms:

    • Investigation of promoter elements controlling petA expression

    • Analysis of transcription factors regulating petA in response to light, nutrients, and stress

    • Comparison with regulation patterns of other photosynthetic components to understand coordination

  • Post-transcriptional controls:

    • Study of mRNA processing, stability, and localization

    • Investigation of potential regulatory RNA elements affecting translation

    • Analysis of codon optimization effects on expression efficiency

  • Post-translational regulation:

    • Identification of potential modification sites affecting protein stability or activity

    • Investigation of proteolytic processing beyond transit peptide removal

    • Study of protein-protein interactions that might regulate cytochrome f function

  • Integration with cellular signaling:

    • Analysis of how photosynthetic electron transport status feeds back to petA expression

    • Investigation of redox signaling pathways affecting cytochrome f synthesis or turnover

    • Study of coordination between nuclear and plastid gene expression

  • Environmental response patterns:

    • Characterization of expression changes under different light qualities and intensities

    • Investigation of temperature, nutrient, and stress effects on petA expression

    • Comparative analysis with other cryptophytes to identify conserved regulatory mechanisms

These research directions would significantly advance our understanding of how nuclear-encoded photosynthetic components are regulated in complex plastid-containing organisms .

How can comparative genomics enhance our understanding of G. theta Apocytochrome f evolution?

Comparative genomics approaches offer powerful insights into the evolution of G. theta Apocytochrome f:

  • Phylogenomic analysis across diverse algal lineages:

    • Construct comprehensive phylogenetic trees of cytochrome f sequences from various photosynthetic organisms

    • Track the evolutionary trajectory of gene transfer events from chloroplast to nucleus

    • Identify convergent versus divergent evolutionary patterns in different lineages with complex plastids

  • Synteny analysis of nuclear petA genes:

    • Compare genomic context of petA genes across cryptophytes and other algae with nuclear-encoded cytochrome f

    • Identify potential co-transferred gene clusters or regulatory elements

    • Investigate chromosome locations to understand patterns of nuclear integration

  • Targeting sequence evolution:

    • Compare transit peptide sequences across cryptophytes and other algae with complex plastids

    • Identify conserved versus variable regions to understand essential targeting features

    • Trace the evolutionary origins of targeting sequence components

  • Adaptation signatures analysis:

    • Apply selection pressure analysis (dN/dS ratios) to identify positively selected sites

    • Compare substitution rates between nuclear and chloroplast-encoded versions

    • Identify lineage-specific acceleration or conservation patterns

  • Horizontal gene transfer assessment:

    • Investigate potential contributions from horizontal gene transfer to petA evolution

    • Distinguish between endosymbiotic gene transfer and other horizontal transfer events

    • Assess the mosaicism of genes encoding interacting partners of cytochrome f

These comparative approaches would provide a comprehensive evolutionary framework for understanding how G. theta Apocytochrome f acquired its unique characteristics and functional adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.