Recombinant Guillardia theta ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to Guillardia theta

Guillardia theta is a cryptomonad alga with significant scientific importance due to its unique cellular structure and evolutionary history. This microorganism possesses complex plastids derived from secondary endosymbiosis, containing four surrounding membranes. G. theta has been extensively studied for its role in understanding the evolutionary relationships between different photosynthetic organisms and for its unique metabolic pathways.

The genome of Guillardia theta contains numerous genes encoding proteins involved in various cellular processes. Among the well-characterized proteins in G. theta are those involved in starch synthesis, where the storage polysaccharide granules contain both amylose and amylopectin fractions with chain length distribution and crystalline organization similar to those found in green algae and land plants . Additionally, this organism possesses 42 genes encoding microbial rhodopsin-like proteins, with 29 confirmed to be expressed in native cells . These characteristics make G. theta an important model organism for studying various biochemical processes, including ATP synthesis.

The physiological responses of G. theta to environmental conditions have been documented, particularly its reaction to nitrogen availability. Studies have shown that nitrogen deficiency induces a color change in exponentially growing cells from brown to green, accompanied by a decrease in chlorophyll a content . This adaptation mechanism involves differential expression of various genes, highlighting the organism's sophisticated regulatory networks.

General Overview of ATP Synthase

ATP synthase is a critical enzyme complex responsible for ATP production, the primary energy currency in biological systems. This molecular machine spans membranes and utilizes the proton gradient established during photosynthesis or respiration to drive the synthesis of ATP from ADP and inorganic phosphate. The enzyme operates through a rotary mechanism, converting the energy stored in electrochemical gradients into chemical energy stored in ATP bonds.

Subunit Composition and Organization

Subunit a, the focus of this article, is a critical component of the F₀ portion of the ATP synthase complex. It plays an essential role in proton translocation across the membrane, working in conjunction with the c-ring to convert the proton gradient into rotational energy. The protein's structure includes multiple transmembrane helices that form part of the proton channel.

Chloroplastic ATP Synthase

In photosynthetic organisms like Guillardia theta, ATP synthase is present in the chloroplast, where it harnesses the proton gradient established during the light reactions of photosynthesis. The chloroplastic ATP synthase (CF₁F₀-ATP synthase) shares structural similarities with mitochondrial and bacterial ATP synthases but has unique features adapted to its function in photosynthetic energy conversion.

Recombinant Protein Expression Systems

Recombinant protein technology allows for the production of proteins outside their native organisms, typically in well-established expression systems like Escherichia coli. Similar to other recombinant proteins from Guillardia theta, such as the ATP-dependent zinc metalloprotease FtsH, the recombinant ATP synthase subunit a can be expressed with affinity tags (such as His-tags) to facilitate purification and subsequent functional studies .

The expression of recombinant proteins from G. theta often involves cloning the target gene into appropriate expression vectors, transformation into host cells, and optimization of expression conditions. For membrane proteins like ATP synthase subunit a, special considerations regarding solubilization and proper folding are necessary to maintain functional integrity.

Gene Structure and Expression

The atpI gene in Guillardia theta encodes the ATP synthase subunit a protein. Like other chloroplastic genes, its expression is regulated in response to environmental conditions and metabolic demands. While specific expression patterns of atpI have not been directly reported in the available search results, studies on G. theta have demonstrated that many genes show differential expression in response to nitrogen availability .

Gene expression analysis in G. theta has revealed complex regulatory networks. For instance, under nitrogen deficient conditions, differential expression of various genes has been observed, with some genes showing significant upregulation and others being downregulated . Understanding the expression patterns of atpI under various environmental conditions would provide insights into the regulation of ATP synthesis in response to changing metabolic demands.

Evolutionary Conservation

ATP synthase is a highly conserved enzyme complex across all domains of life, reflecting its fundamental role in energy metabolism. The chloroplastic ATP synthase in G. theta represents an interesting case for evolutionary study due to the organism's complex history of secondary endosymbiosis.

Comparative genomic analyses of ATP synthase subunits across different organisms provide insights into the evolutionary relationships and functional constraints on these proteins. The study of G. theta's ATP synthase components contributes to our understanding of how this essential enzymatic complex has evolved in organisms with complex plastids.

Role in Energy Metabolism

The ATP synthase complex, including subunit a, plays a central role in energy metabolism in G. theta. By harnessing the proton gradient established during photosynthesis, it generates ATP that powers various cellular processes. The efficiency of this energy conversion process is crucial for the organism's survival and adaptation to changing environmental conditions.

In photosynthetic organisms like G. theta, ATP synthesis is intricately linked with carbon fixation and other metabolic pathways. The regulation of ATP synthase activity is therefore coordinated with photosynthetic efficiency and metabolic demands to maintain energy homeostasis.

Adaptation to Environmental Conditions

G. theta demonstrates remarkable adaptability to varying environmental conditions, as evidenced by its response to nitrogen availability. Studies have shown that nitrogen deficiency triggers substantial changes in gene expression and cellular physiology, including alterations in pigment content and metabolic pathways .

While specific information about the regulation of ATP synthase subunit a under different environmental conditions is not directly available from the search results, it is reasonable to infer that as a component of the essential energy-generating machinery, its expression and activity would be modulated to optimize energy production in response to changing conditions.

Comparative Analysis with ATP Synthases from Other Organisms

Comparative analysis of ATP synthase components from G. theta with those from other organisms, particularly other algae and photosynthetic organisms, can provide insights into the evolution of this essential enzymatic complex and the adaptive strategies employed by different organisms for efficient energy conversion.

Biotechnological Applications

Recombinant proteins from G. theta, including ATP synthase components, have potential applications in biotechnology. The study of these proteins contributes to our understanding of fundamental biological processes and may inspire biomimetic approaches for energy conversion and storage technologies.

The recombinant production of ATP synthase components also facilitates structural and functional studies that are challenging to perform with native proteins. This approach enables detailed investigation of the molecular mechanisms of ATP synthesis and the identification of critical residues involved in protein-protein interactions and catalytic activity.

Implications for Understanding Photosynthetic Energy Conversion

G. theta, with its unique evolutionary history and complex plastid, offers valuable insights into the diversity and adaptation of photosynthetic energy conversion mechanisms. The study of its ATP synthase components, including subunit a, contributes to our understanding of how different organisms have evolved to efficiently harvest light energy and convert it into chemical energy.

Future research directions may include detailed structural analysis of G. theta ATP synthase components, investigation of their regulation under various environmental conditions, and comparative studies with ATP synthases from other organisms to elucidate evolutionary relationships and functional adaptations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
atpI
Target Protein Sequence
MTYNLNCDISNSFYRLAEVEVGKHLYWEIAGFKLHGQVFIVSWLVMLALIIFALNGTRKL NQIPSGIQNFMEYVYEFLQDIAKNQIGEEDYRPWVPYISTVFLFIFGANWAGALIPWKLI QLPEGELAAPTNDINVTVALALLTSISYFYAGISKKGISYFSRYVQPTPILLPINILEDF TKPLSLSFRLFGNVLADELVVSVFALLVPILIPLPVMTLGLFASSVQALIFSTLSAAYIG EALEDHGH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpI) in Guillardia theta chloroplasts?

The chloroplastic ATP synthase subunit a (atpI) in Guillardia theta is a membrane protein that forms part of the F₀ sector of the ATP synthase complex. This protein plays a critical role in proton translocation across the thylakoid membrane during ATP synthesis. Unlike many other ATP synthase components that function primarily in the catalytic mechanism, atpI serves both structural and functional roles, contributing to the assembly and stability of the ATP synthase complex. In Guillardia theta, a marine cryptomonad with plastids obtained through secondary endosymbiosis of a red alga, the atpI protein is particularly significant for maintaining proper ATP synthase function in the unique architecture of its chloroplast .

How is ATP synthase organized in Guillardia theta compared to other photosynthetic organisms?

Guillardia theta possesses a unique organization of ATP synthase that reflects its evolutionary history of secondary endosymbiosis. The ATP synthase complex contains subunits of both plastid and nuclear genetic origin, creating a chimeric protein complex that must be coordinated between two different genetic systems. While the core structure of the ATP synthase (F₁-F₀ complex) is conserved, the peripheral components, including the roles of assembly factors like atpI, may differ from those in primary endosymbionts like green algae and plants. In Guillardia theta, the ATP synthase must function within the context of a complex membrane system that includes four envelope membranes resulting from secondary endosymbiosis, in contrast to the two-membrane envelope system of primary plastids found in green algae and plants .

What experimental approaches are used to study chloroplast ATP synthase assembly in model organisms?

Several experimental approaches have proven valuable for studying chloroplast ATP synthase assembly:

  • Mutant screening: Isolating mutants with defects in ATP synthase assembly, often identified through phenotypes such as high light sensitivity (as demonstrated in Chlamydomonas reinhardtii) .

  • Gene deletion/silencing: Creating targeted knockouts or knockdowns of specific assembly factors to assess their roles. For example, chromosomal deletion of atpI genes has revealed that while not always absolutely essential, these proteins often contribute significantly to ATP synthase stability and function .

  • Protein-protein interaction studies: Using techniques such as co-immunoprecipitation, yeast two-hybrid, or protein crosslinking to identify interacting partners during assembly.

  • Purification and biochemical characterization: Isolating intact ATP synthase complexes and analyzing their composition, stability, and activity. For instance, studies have shown that deletion of atpI can lead to reduced stability of the ATP synthase rotor and reduced membrane association of the F₁ domain .

  • In vitro reconstitution: Cell-free expression systems combined with liposomes have been used to study the requirements for ATP synthase assembly, demonstrating the role of factors like atpI in c-ring formation .

What methods are recommended for expressing and purifying recombinant Guillardia theta atpI protein?

For successful expression and purification of recombinant Guillardia theta atpI protein, the following methodological approach is recommended:

  • Expression system selection: Given the membrane-embedded nature of atpI, specialized expression systems designed for membrane proteins are preferable. E. coli-based systems with modifications for membrane protein expression (such as C41/C43 strains or Lemo21 strain) have shown success for similar proteins.

  • Construct design:

    • Include a fusion tag (His-tag or similar) for purification

    • Consider codon optimization for the expression host

    • Evaluate the use of fusion partners that enhance membrane protein folding and stability

  • Expression conditions:

    • Lower induction temperatures (16-20°C) often improve membrane protein folding

    • Use of specialized media formulations may enhance yield

    • Induction at lower IPTG concentrations (0.1-0.5 mM) for longer periods

  • Solubilization and purification:

    • Use gentle detergents (DDM, LMNG, or similar) for solubilization

    • Employ affinity chromatography based on the chosen tag

    • Consider size exclusion chromatography as a final purification step

    • Maintain detergent concentration above critical micelle concentration throughout

  • Activity assessment: Reconstitution into liposomes may be necessary to evaluate functional integrity, particularly when studying assembly functions of atpI .

How does deletion or mutation of atpI affect ATP synthase stability and function in model photosynthetic organisms?

Studies in various organisms have revealed significant effects of atpI deletion or mutation on ATP synthase stability and function, providing insights that may be relevant to understanding Guillardia theta atpI:

  • Rotor stability: Deletion of atpI leads to reduced stability of the ATP synthase rotor. In studies with alkaliphilic Bacillus pseudofirmus OF4, preparations from mutants with atpI deletion exhibited free c-monomer in the absence of TCA treatment, indicating instability of the c-ring in enzymes assembled without AtpI .

  • Membrane association: AtpI deletion results in reduced membrane association of the F₁ domain. Quantitative immunoblot analysis of membrane fractions from wild type and ΔatpI strains showed approximately 34% reduction in membrane-associated β subunit in the ΔatpI strain, indicating AtpI's role in stabilizing the association of F₁ with the membrane-embedded F₀ .

  • Enzymatic activity: AtpI deletion causes significant reductions in both ATP hydrolysis and ATP-driven proton pumping activities. In B. pseudofirmus OF4, the ΔatpI strain showed more than a 50% reduction in ATP-driven proton-pumping activity relative to wild type, and a 30% reduction in ATPase activity .

  • Yield and assembly: While not absolutely required for ATP synthase assembly in all organisms, AtpI significantly impacts the yield and proper assembly of the complex. Purification yields from ΔatpI strains were distinctly lower (0.7 mg/liter) compared to wild type (1 mg/liter) .

The table below summarizes the quantitative effects of atpI deletion on ATP synthase parameters in B. pseudofirmus OF4:

ParameterWild TypeΔatpIReduction (%)
Membrane-associated F₁ (β subunit)100%~66%~34%
ATP-driven proton pumping100%<50%>50%
ATPase activity (OG-activated)100%~70%~30%
Purification yield1.0 mg/L0.7 mg/L30%

These findings suggest that while atpI may not be absolutely essential for ATP synthase assembly in all organisms, it plays a critical role in ensuring optimal stability and function of the complex .

What are the experimental approaches for investigating atpI's specific role in c-ring assembly during ATP synthase biogenesis?

To investigate atpI's specific role in c-ring assembly during ATP synthase biogenesis, several experimental approaches have proven valuable:

  • In vitro reconstitution systems: Cell-free expression systems such as the PURE system have been used to study c-ring assembly requirements. These systems allow expression of the c-subunit (atpE) with or without atpI, followed by incorporation into liposomes and analysis of c-ring formation. This approach has demonstrated the dependence of c-ring formation on coexpression of atpI with atpE in some organisms .

  • Mutational analysis: Creating specific mutations in atpI and analyzing their effects on c-ring assembly provides insights into critical functional domains. This approach can be complemented by suppressor mutation analysis to identify interacting partners.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify specific interaction sites between atpI and c-subunits during the assembly process.

  • Affinity purification: Expression of tagged versions of atpI has shown that c-rings can copurify with His-tagged forms of AtpI during affinity purification, suggesting direct interaction during assembly .

  • Comparative analysis: Comparing atpI function across different organisms provides evolutionary insights. For example, studies have shown that atpI from Propionigenium modestum was necessary and sufficient for assembly of a hybrid Na⁺-coupled ATP synthase containing an intact c-ring rotor .

  • Time-resolved assembly studies: Pulse-chase experiments with radio-labeled subunits can track the temporal sequence of ATP synthase assembly and determine the stage at which atpI functions.

  • Structural analysis: Cryo-EM or X-ray crystallography of assembly intermediates can provide structural insights into how atpI facilitates c-ring formation.

These methodologies collectively provide a comprehensive approach to elucidating atpI's specific role in c-ring assembly, which appears to involve both chaperone-like functions and direct interactions with c-subunits during the oligomerization process.

How does the chloroplastic atpI of Guillardia theta compare with bacterial homologs in terms of structure and function?

The chloroplastic atpI of Guillardia theta presents an interesting case for comparative analysis with bacterial homologs due to the evolutionary history of chloroplasts as endosymbiotic bacteria. While specific structural data on Guillardia theta atpI is limited, several key comparative aspects can be analyzed:

  • Evolutionary context: The chloroplast of Guillardia theta originated through secondary endosymbiosis of a red alga, creating a more complex evolutionary scenario than primary endosymbiosis seen in green algae and plants. This suggests that Guillardia theta atpI may have distinctive features reflecting its complex evolutionary history .

  • Functional conservation: Despite evolutionary divergence, the core function of atpI appears conserved across bacteria and chloroplasts. In both systems, atpI contributes to ATP synthase assembly and stability, particularly for the membrane-embedded components .

  • Structural adaptations: The chloroplastic atpI likely contains adaptations to function within the thylakoid membrane environment, which differs from bacterial membranes in lipid composition and other physicochemical properties. These adaptations would be reflected in the transmembrane domains and surface-exposed regions of the protein.

  • Interaction network: The protein-protein interaction network of chloroplastic atpI may differ from bacterial counterparts due to the chimeric nature of the chloroplast ATP synthase, which contains subunits of both plastid and nuclear genetic origin .

  • Membrane integration: Studies of bacterial atpI proteins have shown that they function in membrane integration and assembly of ATP synthase components. For example, in bacterial systems like P. modestum, AtpI serves as a chaperone for c-ring assembly, a function that may be conserved in the chloroplastic atpI of Guillardia theta .

  • Complementation analysis: Experiments with bacterial AtpI proteins have shown that they can complement YidC-depleted E. coli strains, indicating functional overlap with membrane protein insertases. Similar experiments with chloroplastic atpI would reveal whether this functional overlap is conserved .

The study of chloroplastic atpI from Guillardia theta provides an opportunity to understand how endosymbiotic events and subsequent evolution have shaped the structure and function of this protein in comparison to its bacterial ancestors.

What role does atpI play in coordinating nuclear and plastid gene expression during ATP synthase biogenesis?

The coordination of nuclear and plastid gene expression is crucial for the biogenesis of chimeric complexes like ATP synthase. While the specific role of atpI in this process in Guillardia theta has not been directly characterized in the search results, several mechanisms can be proposed based on current understanding of ATP synthase biogenesis:

  • Assembly sensor function: AtpI may function as a sensor that monitors the availability of plastid-encoded ATP synthase subunits and communicates this information to nuclear gene expression machinery through retrograde signaling pathways.

  • Stoichiometric balance: By regulating the assembly and stability of plastid-encoded ATP synthase components (particularly the c-ring), atpI could indirectly influence the stoichiometric balance between nuclear and plastid-encoded subunits.

  • Intermediate complex formation: AtpI might facilitate the formation of assembly intermediates that incorporate both nuclear and plastid-encoded subunits, serving as a nucleation point for complex assembly.

  • Regulatory interactions: Studies in Chlamydomonas reinhardtii have identified nuclear factors like MDE1, an octotricopeptide repeat (OPR) protein that stabilizes the chloroplast-encoded atpE mRNA. Similar regulatory interactions may exist in Guillardia theta, potentially involving atpI in a regulatory network .

  • Evolutionary adaptations: The recruitment of factors for ATP synthase assembly represents a nucleus/chloroplast interplay that evolved relatively recently in evolutionary terms. In Chlamydomonas, this interplay developed in the ancestor of the CS clade of Chlorophyceae, approximately 300 million years ago. Similar adaptations may have occurred in the lineage leading to Guillardia theta following secondary endosymbiosis .

Understanding the role of atpI in coordinating nuclear and plastid gene expression during ATP synthase biogenesis in Guillardia theta would provide insights into the mechanisms that ensure proper assembly of this crucial energetic complex in organisms with complex plastid origins.

What experimental challenges exist in expressing functional recombinant chloroplastic atpI from Guillardia theta, and how can they be overcome?

Expressing functional recombinant chloroplastic atpI from Guillardia theta presents several challenges due to its nature as a membrane protein and its chloroplastic origin. Here are the key challenges and strategies to overcome them:

  • Membrane protein expression barriers:

    • Challenge: Membrane proteins often exhibit toxicity to host cells when overexpressed.

    • Solution: Use specialized expression strains like C41/C43 (DE3) E. coli designed for membrane protein expression, or tunable expression systems that allow precise control of expression levels.

  • Protein folding and stability:

    • Challenge: Chloroplastic membrane proteins may misfold in heterologous expression systems.

    • Solution: Express at lower temperatures (16-20°C), use fusion partners that enhance folding (MBP, SUMO, etc.), and optimize culture media composition to support proper folding.

  • Codon usage bias:

    • Challenge: Guillardia theta has different codon usage patterns than common expression hosts.

    • Solution: Synthesize codon-optimized gene constructs for the expression host to enhance translation efficiency.

  • Post-translational modifications:

    • Challenge: Any required post-translational modifications may be absent in heterologous systems.

    • Solution: Consider eukaryotic expression systems that more closely match the native environment or use in vitro modifications if specific modifications are identified.

  • Functional assessment:

    • Challenge: Determining if the recombinant protein is functionally equivalent to the native form.

    • Solution: Develop functional assays based on known atpI activities, such as c-ring assembly facilitation. In vitro reconstitution systems using purified components and liposomes can be valuable for this purpose, similar to approaches used for bacterial atpI proteins .

  • Protein-protein interactions:

    • Challenge: Recombinant atpI may lack its natural interaction partners required for function.

    • Solution: Co-expression with other ATP synthase components, particularly those with which atpI directly interacts, such as c-subunits (atpE).

  • Reconstitution in membranes:

    • Challenge: Maintaining functional structure after extraction from expression host membranes.

    • Solution: Careful selection of detergents for solubilization and purification, followed by reconstitution into liposomes with lipid compositions that mimic the native chloroplast environment. Phosphatidylcholine preparations have been successfully used for reconstitution of ATP synthase components in previous studies .

By addressing these challenges with the suggested strategies, researchers can enhance their chances of successfully expressing and characterizing functional recombinant chloroplastic atpI from Guillardia theta.

What purification strategies have proven most effective for isolating intact ATP synthase complexes containing atpI?

Purification of intact ATP synthase complexes containing atpI requires careful attention to maintaining native protein-protein interactions and membrane protein stability. Based on successful approaches used with other ATP synthase complexes, the following purification strategy is recommended:

  • Membrane preparation:

    • Gently disrupt cells using methods that preserve membrane integrity (e.g., French press, osmotic shock)

    • Isolate thylakoid membranes through differential centrifugation

    • Wash membranes to remove peripheral proteins while retaining membrane-integrated complexes

  • Solubilization:

    • Use mild detergents that preserve protein-protein interactions (e.g., digitonin, n-dodecyl-β-D-maltoside)

    • Optimize detergent:protein ratios to prevent over-solubilization

    • Include stabilizing agents such as glycerol and specific lipids

  • Affinity purification:

    • Engineer a tag on a subunit unlikely to interfere with complex assembly (often the β subunit)

    • For specific isolation of atpI-containing complexes, consider using antibodies against atpI

    • Use gentle elution conditions to maintain complex integrity

  • Size exclusion chromatography:

    • Separate intact complexes from partially assembled intermediates

    • This step effectively removes free subunits and aggregates

  • Density gradient centrifugation:

    • Further purify complexes based on density

    • This approach has been successfully used to isolate intact ATP synthase complexes from various organisms

The effectiveness of this approach is demonstrated by successful purifications of ATP synthase complexes from various organisms, including alkaliphilic bacteria, with yields of approximately 1 mg of F₁F₀ per liter of culture for wild-type strains. Notably, strains with atpI deletions showed reduced yields (0.7-0.8 mg/liter), consistent with atpI's role in complex stability .

Analysis of purified complexes typically involves SDS-PAGE to verify the presence of all subunits, including the c-ring which contains multiple c-subunits in the rotor ring. The integrity of these complexes can be assessed through functional assays such as ATP hydrolysis activity and ATP-driven proton pumping .

How can researchers accurately assess the functional impact of atpI mutations on ATP synthase assembly and activity?

To accurately assess the functional impact of atpI mutations on ATP synthase assembly and activity, researchers should employ a comprehensive set of complementary approaches:

  • Growth phenotype analysis:

    • Compare growth rates on fermentative vs. non-fermentative carbon sources

    • Measure growth yields under different conditions (pH, light intensity for photosynthetic organisms)

    • Assess growth under stress conditions that may exacerbate ATP synthase defects

  • ATP synthase complex quantification:

    • Perform quantitative immunoblotting of ATP synthase subunits in membrane fractions

    • Use density gradient centrifugation to separate fully assembled complexes from assembly intermediates

    • Apply blue native PAGE to analyze complex integrity and abundance

  • Enzyme activity measurements:

    • Measure ATP hydrolysis (ATPase) activity using biochemical assays

    • Assess ATP synthesis rates in isolated organelles or membrane vesicles

    • Determine proton-pumping activity using fluorescent probes or pH indicators

  • Structural analysis of the complex:

    • Examine the stability of key components like the c-ring using SDS-PAGE with and without TCA treatment

    • Use crosslinking approaches to assess subunit interactions

    • Apply electron microscopy techniques to visualize structural changes

  • In vitro reconstitution:

    • Express wild-type and mutant atpI along with c-subunits in cell-free systems

    • Analyze c-ring formation efficiency using gel electrophoresis

    • Use liposome incorporation to assess functionality

A systematic approach using these methods has revealed significant insights in previous studies. For example, analysis of ΔatpI strains of Bacillus pseudofirmus OF4 demonstrated:

  • Reduced stability of the ATP synthase rotor (visible as free c-monomer without TCA treatment)

  • 34% reduction in membrane-associated β subunit content

  • More than 50% reduction in ATP-driven proton-pumping activity

  • 30% reduction in ATPase activity in the presence of octyl-glucoside

  • Modest reduction in non-fermentative growth yield (79% of wild-type at pH 10.5)

These multiple parameters provide a comprehensive assessment of how atpI mutations affect different aspects of ATP synthase function and assembly, from molecular interactions to whole-organism physiology.

What approaches are used to study the interaction between atpI and other ATP synthase assembly factors?

Understanding the interaction network between atpI and other ATP synthase assembly factors requires a multi-faceted approach. The following methods have proven valuable for dissecting these complex interactions:

  • Genetic interaction studies:

    • Double mutant analysis to identify synthetic phenotypes

    • Suppressor screens to identify compensatory mutations

    • Example: Crossing ATP synthase mutants with the ftsh1-1 mutant of the major thylakoid protease identified AtpH as an FTSH substrate and showed that FTSH significantly contributes to the concerted accumulation of ATP synthase subunits

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against atpI to precipitate interacting proteins

    • Reverse Co-IP using antibodies against suspected interaction partners

    • Mass spectrometry identification of co-precipitated proteins

  • Yeast two-hybrid (Y2H) and split-ubiquitin systems:

    • Y2H for soluble domains of membrane proteins

    • Split-ubiquitin for membrane protein interactions

    • Bacterial two-hybrid as an alternative system

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Chemical cross-linking to capture transient interactions

    • MS analysis to identify cross-linked peptides

    • Provides spatial constraints for interaction modeling

  • Fluorescence techniques:

    • Förster resonance energy transfer (FRET) to detect proximal proteins

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

    • Fluorescence recovery after photobleaching (FRAP) to assess dynamics

  • Complementation analysis:

    • Express atpI in strains lacking other assembly factors to test functional overlap

    • Example: Studies have shown that neither atpI nor atpZ complemented a YidC-depleted E. coli strain, while SpoIIIJ and YqjG did, indicating distinct functional roles

  • Proteomics approaches:

    • Quantitative proteomics to compare protein abundance in wild-type vs. mutant backgrounds

    • Protein correlation profiling to identify proteins with similar abundance patterns

    • Complexome profiling to analyze the composition of native protein complexes

These approaches have revealed important insights into atpI interactions. For instance, studies have shown that AtpI can directly interact with c-subunits during rotor assembly, as demonstrated by co-purification of c-rings with His-tagged AtpI . Additionally, the roles of atpI appear distinct from those of YidC-type proteins in some organisms, suggesting parallel assembly pathways .

How can structural biology approaches be applied to understand atpI function in ATP synthase assembly?

Structural biology approaches offer powerful tools for understanding atpI function in ATP synthase assembly. Here's a comprehensive strategy for applying these methods:

These approaches can address several key questions about atpI function:

  • How does atpI recognize and interact with c-subunits during ring assembly?

  • What conformational changes occur in atpI during the assembly process?

  • How is atpI positioned relative to other ATP synthase components?

  • What are the specific interaction interfaces between atpI and its binding partners?

While these structural biology approaches are powerful, they present technical challenges for membrane proteins like atpI. Combining multiple complementary techniques will provide the most comprehensive understanding of atpI structure and function in ATP synthase assembly.

How can understanding atpI function in Guillardia theta contribute to broader knowledge of chloroplast evolution through secondary endosymbiosis?

Understanding atpI function in Guillardia theta provides a unique window into chloroplast evolution through secondary endosymbiosis for several compelling reasons:

  • Evolutionary signature of secondary endosymbiosis: Guillardia theta represents an important evolutionary case where a red alga was engulfed by a eukaryotic host, creating a complex chloroplast with four envelope membranes. The atpI protein in this system potentially carries evolutionary signatures that reflect this complex history .

  • Gene transfer and compartmentalization: The study of atpI and its interactions with nuclear-encoded ATP synthase subunits can reveal mechanisms of gene transfer between compartments. In Guillardia theta, the complete sequencing of nucleus, nucleomorph, and plastid genomes provides a comprehensive dataset for tracking gene transfer events and the subsequent coordination of gene expression .

  • Functional adaptation: Comparing atpI function between Guillardia theta and organisms with primary plastids can reveal adaptations specific to the secondary endosymbiotic context. These adaptations may include modifications to protein targeting, assembly pathways, and regulatory mechanisms.

  • Assembly factor evolution: The recruitment of assembly factors for chloroplast protein complexes represents an important aspect of endosymbiotic integration. Studies in Chlamydomonas reinhardtii have shown that the recruitment of factors like MDE1 for ATP synthase assembly occurred relatively recently (~300 My ago) in evolutionary terms . Similar analysis of assembly factors in Guillardia theta could reveal parallel or convergent evolutionary solutions.

  • Regulatory network integration: The coordination between host nucleus, nucleomorph, and plastid genomes in Guillardia theta represents a more complex regulatory challenge than in organisms with primary plastids. Understanding how atpI functions within this network can illuminate evolutionary solutions to multi-genome coordination.

  • Comparison with primary endosymbiosis: Contrasting atpI function between Guillardia theta and organisms with primary plastids can highlight different evolutionary trajectories and constraints in these distinct endosymbiotic events.

  • Model for complex plastid evolution: Insights from Guillardia theta atpI function can inform broader models of how complex plastids evolved and how protein complexes like ATP synthase maintain functionality despite the increased complexity of genetic compartmentalization.

This research direction not only advances fundamental understanding of chloroplast evolution but also provides insights into the general principles governing the integration of endosymbionts into host cells, a process central to the evolution of eukaryotic complexity.

What emerging technologies hold promise for advancing research on atpI function in chloroplastic ATP synthase assembly?

Several emerging technologies hold significant promise for advancing research on atpI function in chloroplastic ATP synthase assembly:

  • Cryo-electron tomography (cryo-ET):

    • This technique allows visualization of macromolecular complexes in their native cellular environment.

    • For atpI research, cryo-ET could reveal the spatial arrangement of ATP synthase assembly intermediates within thylakoid membranes, providing insights into how atpI facilitates assembly in vivo.

  • Single-molecule techniques:

    • Single-molecule FRET (smFRET) can track conformational changes in atpI during interactions with other proteins.

    • Optical tweezers or atomic force microscopy could measure forces involved in assembly processes.

  • Mass photometry/interferometric scattering microscopy:

    • These techniques allow measurement of the mass and stoichiometry of membrane protein complexes without labeling.

    • They could provide real-time monitoring of ATP synthase assembly steps involving atpI.

  • In-cell structural biology:

    • Methods such as in-cell NMR and electron paramagnetic resonance (EPR) spectroscopy can provide structural information in native cellular environments.

    • These approaches could reveal how atpI structure and dynamics differ between isolated systems and the native chloroplast environment.

  • Genome editing in Guillardia theta:

    • Development of CRISPR-Cas9 systems optimized for Guillardia theta would enable precise genetic manipulation.

    • This would facilitate creation of targeted mutations in atpI and interacting proteins, similar to approaches that have been successful in Chlamydomonas reinhardtii .

  • Proximity labeling proteomics:

    • Techniques like BioID or APEX2 fused to atpI could identify transient interaction partners during different stages of assembly.

    • This would provide a comprehensive view of the atpI interactome in vivo.

  • Synthetic biology approaches:

    • Reconstitution of minimal ATP synthase assembly systems with defined components.

    • This could determine the sufficient and necessary factors for atpI-mediated assembly steps.

  • Molecular dynamics simulations with enhanced sampling:

    • Advanced computational methods could model membrane protein dynamics over physiologically relevant timescales.

    • These simulations could predict key conformational changes and interaction interfaces of atpI during assembly.

  • Time-resolved structural methods:

    • Methods such as time-resolved cryo-EM and X-ray free-electron laser (XFEL) crystallography can capture transient structural states.

    • These techniques could visualize intermediate steps in atpI-mediated assembly processes.

  • Microfluidics-based approaches:

    • Allow precise control of chemical environments for in vitro reconstitution experiments.

    • Could enable high-throughput screening of conditions affecting atpI function in ATP synthase assembly.

The integration of these emerging technologies promises to provide unprecedented insights into the molecular mechanisms by which atpI facilitates chloroplastic ATP synthase assembly in Guillardia theta and other photosynthetic organisms.

What comparative genomics approaches can reveal about the evolution and diversification of atpI across different photosynthetic lineages?

Comparative genomics offers powerful approaches to understand the evolution and diversification of atpI across photosynthetic lineages:

These comparative genomics approaches could address several key questions about atpI evolution:

  • How has atpI function diversified after the secondary endosymbiotic event that gave rise to Guillardia theta's chloroplast?

  • What unique sequence features characterize atpI in cryptophytes compared to other photosynthetic lineages?

  • Have gene transfer events between chloroplast and nuclear genomes affected atpI evolution differently across lineages?

Such analyses would contribute significantly to understanding both the conserved core functions of atpI and the lineage-specific adaptations that have occurred during the diversification of photosynthetic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.