Recombinant Guillardia theta ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Function and Significance

ATP synthase uses the proton motive force (pmf) created by thylakoid electron transport reactions to produce ATP . The pmf-activation involves interaction between the γ subunit and the CF1 complex .

Guillardia theta, a species of algae, possesses a chloroplast ATP synthase with unique characteristics. Research on algal ATP synthases, particularly from species like Chlamydomonas reinhardtii, provides insights into the structure, function, and regulation of these enzymes .

Regulation

ATP synthase is regulated at multiple levels, including pmf-activation and redox regulation . The γ subunit is involved in the redox regulation of ATP synthesis in vivo . Additionally, nucleus-encoded subunits of the chloroplast ATP synthase can regulate the synthesis of chloroplast-encoded subunits at the level of translation initiation .

Experimental Studies

  • Translation Initiation: Studies on Chlamydomonas reinhardtii have shown that the beta subunit of ATP synthase is not synthesized with an N-terminal leader sequence . Translation initiates exclusively at the second ATG codon within the atpB gene .

  • Overexpression of Subunits: Overexpression of the AtpD subunit in rice enhances the abundance and activity of the chloroplast ATP synthase, leading to higher CO₂ assimilation rates and increased electron transport .

  • Subunit Interactions: Research indicates that subunit b is crucial for the stability and assembly of the ATP synthase complex. In the absence of subunit γ, the translation and accumulation of subunit b are significantly reduced .

Aberrations and Mutations

Mutations affecting ATP synthase subunits can lead to impaired ATP synthesis and reduced growth. For instance, mutant cybrids expressing C. reinhardtii ATP6F showed increased ATP synthesis, demonstrating the importance of proper subunit assembly for function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
atpF
Target Protein Sequence
MDIISGFYNTINLAELSNAKTFGFNPNILEANVLNIAILLSGVIYLGRNFLTSALESRQQ KVTEAIQEAEERLQQANVKLLDAEKQLTQAQTVIEQIKKEAEKTARTVKETILAQGKLDI ERLTNNGKSSIEKAELQIKKQIQQHITDLAIKKVSAQMETFMTDNLQVKVIDTNIASLGG KI
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of ATP synthase subunit b (atpF) in Guillardia theta chloroplasts?

    ATP synthase subunit b (atpF) serves as a critical component of the peripheral stalk in chloroplast ATP synthase. This stalk functions as a static connection between the membrane-embedded F₀ motor and the F₁ catalytic head, preventing rotation of the F₁ stator during ATP synthesis. The peripheral stalk redistributes differences in torsional energy across the rotation cycle, enabling the efficient coupling of proton movement to ATP synthesis. In chloroplasts, atpF helps maintain the structural integrity of the ATP synthase complex during photosynthesis-driven ATP production .

  • How does chloroplastic atpF differ from mitochondrial ATP synthase subunits?

    Chloroplastic atpF differs from its mitochondrial counterparts in several key aspects:

    • Regulatory mechanisms: Chloroplastic ATP synthase contains plant-specific redox switches that inhibit rotation in the dark, a feature absent in mitochondrial ATP synthase .

    • Genetic origin: Chloroplastic atpF is typically encoded by the chloroplast genome, whereas mitochondrial ATP synthase subunits are encoded by nuclear DNA in most eukaryotes.

    • Structure: The peripheral stalk in chloroplastic ATP synthase has evolved specific adaptations to function within the thylakoid membrane environment.

    • Proton source: Chloroplastic ATP synthase utilizes protons generated by photosynthetic electron transport, while mitochondrial ATP synthase uses protons from the respiratory chain .

  • What expression systems are typically used for recombinant production of chloroplastic atpF?

    Several expression systems can be employed for recombinant production of chloroplastic atpF:

    • Bacterial systems (E. coli): Most commonly used due to rapid growth and high protein yields

    • Yeast systems: Similar to what's used for mitochondrial ATP synthase subunits, providing eukaryotic post-translational modifications

    • Algal expression systems: Can maintain native folding environment for chloroplastic proteins

    The choice depends on research objectives. For structural studies requiring high protein purity, bacterial or yeast systems like those used for ATP5F1B may be preferred . For functional studies, algal systems might better preserve native interactions. Expression typically involves cloning the atpF gene into a suitable vector with a purification tag (such as 6xHis) at the N-terminus to facilitate downstream purification .

Methodological Approaches

  • What purification strategy yields the highest activity for recombinant Guillardia theta atpF?

    An optimized purification strategy for recombinant G. theta atpF typically involves:

    1. Construct design: Clone atpF with an N-terminal 6xHis-tag, similar to approaches used for ATP5F1B

    2. Expression system selection: Use either bacterial (E. coli) or yeast systems

    3. Cell lysis: Gentle disruption using non-ionic detergents to preserve protein structure

    4. Initial purification:

      • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

      • Wash with increasing imidazole concentrations (10-40 mM)

      • Elute with 250-500 mM imidazole

    5. Secondary purification:

      • Ion exchange chromatography (typically anion exchange)

      • Size exclusion chromatography to remove aggregates and ensure homogeneity

    6. Quality control:

      • SDS-PAGE to assess purity (aim for >90% purity)

      • Western blot to confirm identity

      • Mass spectrometry to verify the exact molecular weight

    For researchers requiring functional protein, including a stabilizing detergent (such as DDM or LMNG) throughout purification helps maintain the native conformation. This approach typically yields protein with >90% purity and preserved structure suitable for functional and structural studies .

  • How can researchers effectively reconstitute functional ATP synthase complexes using recombinant atpF?

    Reconstitution of functional ATP synthase complexes with recombinant atpF requires a systematic approach:

    1. Component preparation:

      • Purify individual ATP synthase subunits (including recombinant atpF)

      • Prepare suitable lipid mixtures (typically DOPC/POPE/POPG)

    2. Assembly protocol:

      • Sequential addition of subunits in the presence of chaperones

      • Alternatively, co-expression of multiple subunits followed by complex purification

    3. Membrane incorporation:

      • Detergent dialysis method: Mix protein complex with detergent-solubilized lipids, then remove detergent via dialysis

      • Direct incorporation into liposomes or nanodiscs for functional studies

    4. Functional validation:

      • ATP synthesis assay using artificial proton gradient

      • Proton pumping assays using pH-sensitive fluorescent dyes

      • Rotational assays using single-molecule techniques

    Researchers should note that reconstitution efficiency is typically assessed through:

    • Cryo-EM analysis of the assembled complex

    • BN-PAGE to confirm complex formation

    • ATP synthesis rates compared to native enzyme preparations

    This approach allows detailed structure-function studies of how atpF contributes to ATP synthase activity.

  • What are the key considerations when designing site-directed mutagenesis experiments for Guillardia theta atpF?

    When designing site-directed mutagenesis experiments for G. theta atpF, researchers should consider:

    1. Target selection:

      • Interface residues that contact other peripheral stalk components

      • Conserved residues identified through multiple sequence alignment

      • Regions implicated in peripheral stalk flexibility and function

      • Potential redox-sensitive residues (cysteines)

    2. Mutation design principles:

      • Conservative mutations (e.g., Leu→Ile) to subtly alter properties

      • Charge-altering mutations (e.g., Lys→Glu) to disrupt electrostatic interactions

      • Introduction/removal of cysteine residues to test redox sensitivity

      • Structure-guided design based on available ATP synthase structures

    3. Controls and validation:

      • Create parallel mutations in equivalent positions of well-studied organisms

      • Include wild-type controls in all experiments

      • Verify expression levels by Western blotting

      • Confirm proper folding through circular dichroism

    4. Functional assessment:

      • ATP synthesis activity measurements

      • Assembly analysis via BN-PAGE

      • Structural analysis through cryo-EM or crosslinking studies

    When analyzing results, researchers should consider that peripheral stalk components like atpF have different effects on ATP synthase biogenesis and function, as demonstrated by studies of AtpF and ATPG in Chlamydomonas reinhardtii .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.