Recombinant Guillardia theta ATP synthase subunit b', chloroplastic (atpG)

Shipped with Ice Packs
In Stock

Description

ATP Synthase Subunit b' (atpG) Overview

The ATP synthase subunit b' (atpG) is a peripheral stalk subunit critical for stabilizing the rotor-stator interface in the chloroplast ATP synthase complex. In green algae, it interacts with subunit b (encoded by atpF) to form a heterodimer that connects the CF₀ and CF₁ sectors .

Key Features of ATP Synthase Subunits

SubunitGeneOrganismFunctionReferences
b'atpGVaucheria litoreaPeripheral stalk stabilization
batpFGuillardia thetaPeripheral stalk component
batpFOchrosphaera neapolitanaProton channel stabilization

Recombinant ATP Synthase Subunits: A Comparative Analysis

While data on Guillardia theta atpG is absent, recombinant ATP synthase subunits from other organisms are well-documented. Below is a comparison of available recombinant proteins:

OrganismSubunitGeneProtein LengthExpression SystemPurityUniprot IDSource
Vaucheria litoreab'atpG1–154 aaE. coli>90%B7T1R9
Ochrosphaera neapolitanab'atpG1–163 aaE. coli>90%Q40608
Guillardia thetabatpFPartialE. coli>85%O78477

Note: The Guillardia theta entry refers to subunit b (atpF), not b' (atpG).

Lack of Specific Data on Guillardia theta atpG

No studies or product listings explicitly describe the recombinant Guillardia theta atpG protein. This contrasts with detailed profiles for subunit b' in Vaucheria litorea and Ochrosphaera neapolitana .

Functional Insights from Homologs

  • Subunit b' (atpG) in Vaucheria litorea and Ochrosphaera neapolitana includes a His-tag for purification and is expressed in E. coli .

  • Subunit b (atpF) in Guillardia theta is partially characterized but lacks full-length sequence data .

Mechanistic and Biotechnological Relevance

ATP synthase subunits are critical for:

  1. Thylakoid Membrane Stability: Peripheral stalk subunits (b and b') prevent dissociation of CF₀ and CF₁ sectors .

  2. Proton Translocation: The b-b' heterodimer facilitates proton flow through the CF₀ sector .

  3. Biogenesis Regulation: PPR proteins (e.g., BFA2) stabilize atpH/F transcripts, ensuring subunit production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
atpG
Target Protein Sequence
MTNYLYILALQIAEAESEGGLFDFNATLPLMAVQILLFMVILNAVFYNPVAKVLDEREEY IRKNLTQASDILAKAEAITKQYEKDLAQERREAQLIISVAQKEAQDIVALEIKQAQKDTE LLVNEATSQLNSQKQKALSALEDQVNTLTEQIKSKLLSNQLIS
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b'-subunit, a component of the F(0) channel and part of the peripheral stalk, links F(1) and F(0). In plants and photosynthetic bacteria, b' is a divergent and duplicated form of the b subunit.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Guillardia theta and why is it significant as a research organism?

Guillardia theta is a marine biflagellate cryptomonad alga with a plastid obtained through secondary endosymbiosis of a red alga. Though rare in the wild, it cultures well and has been extensively studied since its discovery in Connecticut by Richard Guillard in the 1960s .

The organism is particularly significant because:

  • It is the only cryptomonad to have its entire nucleus, nucleomorph, and plastid genome sequenced

  • It serves as a model organism for studying secondary endosymbiosis and photosynthesis in cryptomonads

  • It provides insights into gene transfer between chloroplast, the ancestral red algal nucleomorph, and the nucleus

  • The process of endosymbiosis represented by Guillardia theta has been a fundamental force in the origin and diversification of eukaryotic life

What is the structure and function of ATP synthase subunit b' (atpG) in chloroplasts?

ATP synthase subunit b' (atpG) forms a crucial component of the peripheral stalk in chloroplast ATP synthase. This multi-subunit nanomotor complex contains subunits of both plastid and nuclear genetic origin .

Function:

  • atpG works alongside subunit b (encoded by atpF) to form the peripheral stalk that connects the membrane-embedded F₀ sector to the catalytic F₁ sector of ATP synthase

  • The peripheral stalk acts as a stator that prevents rotation of specific components during ATP synthesis

  • It helps maintain the structural integrity of the ATP synthase complex during the rotational catalysis process

Protein characteristics:

  • The mature protein consists of 163 amino acids as characterized in Guillardia theta

  • The amino acid sequence includes: MTNYLYILALQIAEAESEGGLFDFNATLPLMAVQILLFMVILNAVFYNPVAKVLDEREEYIRKNLTQASDILAKAEAITKQYEKDLAQERREAQLIISVAQKEAQDIVALEIKQAQKDTELLVNEATSQLNSQKQKALSALEDQVNTLTEQIKSKLLSNQLIS

What are recommended approaches for recombinant expression of Guillardia theta atpG?

Based on research protocols with related ATP synthase components, the following methodological approaches are recommended:

Expression Systems:

  • Mammalian cell expression systems have been successfully used for recombinant production of other Guillardia theta ATP synthase components (as seen with atpE)

  • E. coli expression systems have been employed for heterologous expression of related ATP synthase subunits from other organisms

Protocol Considerations:

  • Use of a tag system (determined during the manufacturing process) to facilitate purification

  • Storage in Tris-based buffer with 50% glycerol for optimal stability

  • Storage at -20°C for extended periods, with working aliquots maintained at 4°C for up to one week

  • Avoiding repeated freeze-thaw cycles which can compromise protein integrity

Quality Control:

  • Verification of purity via SDS-PAGE (target >85% purity)

  • Consider reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

How can researchers effectively analyze ATP synthase assembly and function when studying atpG?

Researchers investigating ATP synthase assembly and function in relation to atpG can employ several methodological approaches:

Genetic Manipulation Approaches:

  • CRISPR-Cas9 gene editing for creating knockout mutants (as demonstrated in Chlamydomonas reinhardtii)

  • Introduction of transposon insertions in the 3′UTR of ATPG to create knockdown mutants

  • Construction of chimeric genes to study specific gene regions

Functional Analysis Techniques:

  • Mass spectrometry to quantify ATP synthase accumulation in mutants

  • Crossing ATP synthase mutants with other relevant mutants (e.g., ftsh1-1 protease mutant) to study protein degradation pathways

  • Screening for high light sensitivity as a phenotypic indicator of ATP synthase dysfunction

Comparative Analysis:

  • Use of frame-shift mutants as comparators for complete loss of function

  • Parallel analysis of multiple subunit mutants (e.g., atpF and ATPG) to understand coordinated biogenesis

What is known about the coordinated biogenesis of ATP synthase and the specific role of atpG?

The biogenesis of ATP synthase involves complex coordination between nuclear and plastid-encoded subunits. Research in Chlamydomonas reinhardtii provides valuable insights applicable to Guillardia theta:

Key Findings on ATP Synthase Biogenesis:

  • Chloroplast ATP synthase contains subunits encoded by both the chloroplast and nuclear genomes, requiring coordinated expression and assembly

  • The peripheral stalk subunits b and b′ (encoded by atpF and ATPG, respectively) are essential for ATP synthase function and accumulation

  • Knockout ATPG mutants completely prevent ATP synthase function and accumulation, as does an atpF frame-shift mutation

  • Knockdown ATPG mutants (with a transposon insertion in the 3′UTR) allow small accumulation of functional ATP synthase

  • The FTSH protease significantly contributes to the concerted accumulation of ATP synthase subunits

Regulatory Mechanisms:

  • Nuclear-encoded factors like MDE1 (an octotricopeptide repeat protein) are required to stabilize chloroplast-encoded transcripts (e.g., atpE mRNA)

  • Transcript stabilization represents a key regulatory mechanism in coordinating nuclear and chloroplast contributions to ATP synthase assembly

How has the atpG gene evolved in the context of endosymbiosis and what does this reveal about organellar evolution?

The evolution of atpG provides insights into the broader evolutionary processes of endosymbiosis and organellar development:

Evolutionary Context:

  • The primary endosymbiotic origin of plastids occurred more than a billion years ago, giving rise to green algae, red algae, and glaucophytes

  • Guillardia theta represents a secondary endosymbiotic event where a non-photosynthetic host engulfed and retained a red algal cell

  • This cryptomonad still possesses the nucleus (nucleomorph) and cytoplasm of its algal endosymbiont in a highly reduced form

Genetic Transfer and Integration:

  • The limited coding capacity of the nucleomorph and plastid indicates that the nuclear genome has served as a repository for thousands of endosymbiont-derived genes

  • The study of the Guillardia theta genome reveals host-endosymbiont integration patterns at genetic, biochemical, and cellular levels

  • Whole genome analyses of G. theta show significant red and green algal contributions to this derived algal lineage

  • The recruitment of nuclear-encoded factors to regulate chloroplast gene expression (e.g., MDE1 for atpE) exemplifies the nucleus/chloroplast interplay that evolved approximately 300 million years ago

What are common challenges when working with recombinant atpG and how can they be addressed?

Based on documented experiences with similar chloroplast proteins from Guillardia theta and related organisms:

Storage and Stability Challenges:

  • Problem: Protein degradation during storage

  • Solution: Store recombinant protein at -20°C/-80°C with 50% glycerol; avoid repeated freeze-thaw cycles

  • Solution: For working aliquots, store at 4°C for no more than one week

Expression and Purification Challenges:

  • Problem: Low expression levels

  • Solution: Optimize codon usage for the expression host system

  • Problem: Insufficient purity

  • Solution: Employ appropriate tag systems determined during manufacturing process combined with optimized purification protocols targeting >85% purity via SDS-PAGE

Functional Verification Challenges:

  • Problem: Confirming proper folding and functionality

  • Solution: Combine structural analyses with functional assays comparing wild-type and mutant versions

  • Problem: Assessing interaction with other ATP synthase components

  • Solution: Employ predicted structural models based on comparative modeling with known templates (e.g., E. coli delta-subunit or bovine OSCP)

How can researchers effectively analyze the impact of atpG mutations on ATP synthase function?

Based on methodologies employed in the study of ATP synthase subunits:

Experimental Design Approaches:

  • Generate a spectrum of mutations: knockout mutants via CRISPR-Cas9, knockdown mutants via transposon insertions, and specific amino acid substitutions

  • Create an atpF frame-shift mutant for comparison to understand peripheral stalk function more comprehensively

  • Develop chimeric genes to identify critical regions of the protein

Analytical Methods:

  • Screen for phenotypic indicators such as high light sensitivity

  • Quantify ATP synthase accumulation via mass spectrometry

  • Assess ATP synthase function through photosynthesis measurements

  • Cross mutants with protease mutants (e.g., ftsh1-1) to understand protein stability and degradation mechanisms

Data Analysis Framework:

  • Compare knockdown vs. knockout phenotypes to understand threshold requirements for AtpG

  • Analyze the concerted accumulation of other ATP synthase subunits to understand assembly dependencies

  • Correlate structural predictions with functional outcomes to identify critical domains

What emerging techniques could advance our understanding of atpG structure and function?

Several cutting-edge approaches show promise for deepening our understanding of ATP synthase subunit b':

Structural Biology Approaches:

  • Cryo-electron microscopy for high-resolution structural analysis of the entire ATP synthase complex including the peripheral stalk

  • Ab initio structure predictions using advanced computational methods as demonstrated for related ATP synthase subunits

  • Comparative modeling using established templates like E. coli delta-subunit (PDB code: 1abv) and bovine OSCP (PDB code: 2bo5)

Advanced Genetic Engineering:

  • Application of CRISPR-Cas9 for precise gene editing to study specific domains within atpG

  • Development of inducible expression systems to control atpG expression levels temporally

  • Creation of fluorescently tagged versions for live-cell imaging of ATP synthase assembly

Physiological and Environmental Studies:

  • Investigation of atpG expression patterns under various growth conditions, similar to studies on rhodopsin-like genes in Guillardia theta

  • Exploration of the role of atpG in adaptation to different light and nutrient conditions

  • Comparative studies across different algal lineages to understand evolutionary adaptations

How might research on atpG contribute to our broader understanding of endosymbiosis and organellar evolution?

Research on Guillardia theta atpG has significant implications for understanding broader evolutionary processes:

Evolutionary Insights:

  • The study of nuclear-encoded ATP synthase components like atpG provides a window into gene transfer from endosymbiont to host during evolution

  • Understanding the coordinated expression of nuclear and plastid-encoded ATP synthase components illuminates the integration process during endosymbiosis

  • Comparative analyses of atpG across different cryptomonads and other secondary endosymbionts can reveal convergent and divergent evolutionary pathways

Theoretical Frameworks:

  • Research on atpG supports models of organellar evolution that emphasize the importance of gene transfer and regulatory network integration

  • The nuclear regulation of chloroplast gene expression (as seen with MDE1 regulating atpE) provides insight into the evolution of nuclear control over organellar function

  • Studies of ATP synthase assembly and function contribute to understanding how complex multisubunit complexes evolve in compartmentalized cells

Implications for Synthetic Biology:

  • Knowledge of atpG structure and function could inform efforts to engineer artificial organelles or optimize energy production in synthetic biological systems

  • Understanding the minimal requirements for ATP synthase function could guide the design of simplified energy-generating systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.