Recombinant Guillardia theta Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
petD
Target Protein Sequence
MSVLKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTLACVIGLSVLAPS PIGEKADPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPVGLITVPFIESVNKF QNPFRRPVAMTVFVFSVVFAIWLGIGATMPINKALTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does the petD gene play in its function?

The Cytochrome b6-f complex is an essential component of the photosynthetic electron transport chain, functioning between Photosystem II and Photosystem I. It catalyzes the transfer of electrons from plastoquinol to plastocyanin while pumping protons across the thylakoid membrane, contributing to the proton gradient used for ATP synthesis.

The petD gene encodes subunit IV of the cytochrome b6-f complex, which is indispensable for the proper functioning of this multiprotein complex. Subunit IV forms part of the core structure alongside cytochrome b6, cytochrome f, and the Rieske iron-sulfur protein. Without functional subunit IV, the cytochrome b6-f complex cannot assemble properly, severely compromising photosynthetic efficiency .

How is the genetic organization of petD typically arranged in photosynthetic organisms?

  • Prokaryotic-like gene organization

  • Absence of introns in most species

  • Chloroplast-specific codon usage patterns

  • Co-transcription with other photosynthetic genes

When petD has migrated to the nucleus, as observed in Euglena gracilis, it acquires nuclear gene characteristics:

FeatureChloroplast-encoded petDNuclear-encoded petD
Codon usagePlastid-typeNuclear-type
Transit peptideAbsentPresent (for chloroplast targeting)
PolyadenylationAbsentPresent
Promoter elementsPlastid-specificNuclear-specific
IntronsTypically absentMay be present

In Euglena gracilis, the nuclear localization of petD represents an evolutionary adaptation related to the secondary endosymbiotic origin of its chloroplasts .

What are the structural characteristics of Cytochrome b6-f complex subunit 4 that researchers should consider when designing recombinant expression systems?

When designing expression systems for recombinant production of Guillardia theta petD, researchers should consider several key structural characteristics:

  • Membrane protein nature: Subunit IV is an integral membrane protein with transmembrane helices, requiring specialized expression systems capable of proper membrane protein folding.

  • Protein-protein interaction domains: Subunit IV interacts extensively with cytochrome b6 and other components of the complex, necessitating consideration of these interaction surfaces during recombinant design.

  • Conserved residues: Highly conserved amino acid positions indicate functionally crucial regions that should not be modified during construct design .

  • Signal sequences: If expressing the nuclear-encoded form, the construct must include appropriate chloroplast transit peptide sequences for proper targeting.

  • Hydrophobic domains: The presence of multiple hydrophobic regions requires careful consideration when designing purification strategies to maintain protein stability and prevent aggregation.

What methodologies are most effective for recombinant expression of Guillardia theta petD protein?

Successful recombinant expression of membrane proteins like cytochrome b6-f complex subunit 4 requires careful consideration of expression systems. Based on research with similar proteins, the following methodological approaches are recommended:

Expression system selection:

  • E. coli-based systems: The pET-21d(+) vector system has proven effective for expression of complex proteins with proper folding . For membrane proteins like petD, consider specialized E. coli strains such as C41(DE3) or C43(DE3) that are engineered for membrane protein expression.

  • Eukaryotic systems: For proteins requiring post-translational modifications, yeast (Pichia pastoris) or insect cell (Sf9) expression systems may provide advantages.

Optimization strategies:

  • Use codon optimization for the host organism

  • Include fusion tags (His6, MBP, or SUMO) to enhance solubility

  • Express at lower temperatures (16-20°C) to improve folding

  • Include membrane-mimetic environments during purification

  • Co-express with chaperone proteins to assist folding

Purification protocol:

  • Gentle cell lysis using specialized detergents (DDM, LDAO)

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography to isolate properly folded protein

  • Validation of structural integrity using circular dichroism spectroscopy

How can researchers analyze the evolutionary migration of petD from chloroplast to nucleus in Guillardia theta compared to other species?

Analyzing the evolutionary migration of petD requires a comprehensive comparative genomics approach:

Methodological workflow:

  • Genome sequencing and assembly:

    • Obtain high-quality genomic data from Guillardia theta

    • Assemble both nuclear and organellar genomes

    • Perform targeted PCR verification of gene locations

  • Comparative genomic analysis:

    • Analyze codon usage patterns using tools like CodonW

    • Calculate GC content and codon adaptation index

    • Identify nuclear transit peptides using programs like TargetP

    • Perform phylogenetic analysis of petD sequences across diverse species

  • Transcriptome analysis:

    • Verify expression through RT-PCR and RNA-Seq

    • Identify transcription start sites and polyadenylation signals

    • Map pre-mRNA processing sites

  • Evolutionary analysis:

    • Examine synteny across related species

    • Identify remnant sequences in chloroplast genome

    • Calculate selection pressures using dN/dS ratios

In Euglena gracilis, research demonstrated that petD exhibits typical nuclear codon usage, contains a polyadenylation signal, and encodes a chloroplast transit peptide—all hallmarks of gene migration from chloroplast to nucleus . Similar approaches can be applied to Guillardia theta to determine if its petD gene followed a similar evolutionary path.

What techniques should be employed to verify proper folding and functionality of recombinantly expressed Guillardia theta petD protein?

Verifying proper folding and functionality of recombinant membrane proteins requires multiple complementary approaches:

Structural validation techniques:

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can reveal properly folded tertiary structures, as demonstrated for other recombinant proteins .

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure elements (α-helices, β-sheets) to confirm proper folding.

  • Limited proteolysis: Properly folded proteins show resistance to limited proteolytic digestion compared to misfolded variants.

  • Thermal shift assays: Monitor protein stability under various conditions to optimize buffers for structural integrity.

Functional validation approaches:

  • Binding assays: Verify interaction with known binding partners using techniques such as:

    • Surface plasmon resonance

    • Isothermal titration calorimetry

    • Pull-down assays with other complex components

  • Reconstitution experiments: Attempt to reconstitute partial or complete cytochrome b6-f complexes using the recombinant subunit.

  • Electron transport assays: Measure electron transfer capabilities in reconstituted proteoliposomes.

Data table for validation experiments:

Validation techniqueExpected outcomeTroubleshooting
Fluorescence spectroscopyEmission maximum at ~330-340 nmRed-shifted spectrum (>350 nm) indicates misfolding
CD spectroscopyα-helical signature for transmembrane domainsRandom coil patterns suggest denaturation
Limited proteolysisDistinct, stable fragmentsComplete digestion indicates improper folding
Thermal shiftMelting temperature >45°CLow Tm values suggest instability
Complex formationCo-purification with cytochrome b6Absence of interaction may require optimized conditions

What strategies can researchers employ to study the role of post-translational modifications in Guillardia theta petD function?

Post-translational modifications (PTMs) often play crucial roles in protein function, particularly for proteins that have relocated from organellar to nuclear genomes. To study PTMs in Guillardia theta petD:

Identification strategies:

  • Mass spectrometry approaches:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted MS methods (MRM/PRM) for specific modifications

  • Site-directed mutagenesis:

    • Mutate putative modification sites to non-modifiable residues

    • Create phosphomimetic mutations (S/T→D/E)

    • Express variants and assess functional differences

  • Antibody-based detection:

    • Generate modification-specific antibodies

    • Western blotting with anti-PTM antibodies

    • Immunoprecipitation followed by MS analysis

Functional analysis of PTMs:

  • In vitro enzymatic assays:

    • Perform in vitro dephosphorylation/deacetylation

    • Compare activity before and after modification removal

  • Structural analysis:

    • Compare structures of modified vs. unmodified protein

    • MD simulations to predict effects of modifications

  • Temporal dynamics:

    • Track modifications under different physiological conditions

    • Monitor changes during light/dark transitions

For nuclear-encoded chloroplast proteins like petD, phosphorylation often regulates import into chloroplasts and protein-protein interactions within complexes. The tripartite nature of chloroplast transit peptides in secondary endosymbionts like Guillardia theta adds complexity to this regulation .

How can computational approaches enhance understanding of structure-function relationships in Guillardia theta petD?

Computational approaches provide powerful tools for understanding petD structure-function relationships when experimental data is limited:

Structural prediction and analysis:

  • Homology modeling:

    • Identify suitable templates (e.g., crystal structures of cytochrome b6-f complexes)

    • Generate models using tools like SWISS-MODEL and Phyre2

    • Validate models using PROCHECK and MolProbity

  • Molecular dynamics simulations:

    • Embed protein models in membrane bilayers

    • Simulate dynamics in physiological conditions

    • Analyze stability, flexibility, and conformational changes

  • Protein-protein interaction prediction:

    • Dock petD with other cytochrome b6-f components

    • Identify critical interaction residues

    • Calculate binding energies and stability

Conservation and evolutionary analysis:

  • Multiple sequence alignment:

    • Align petD sequences across diverse photosynthetic organisms

    • Identify universally conserved vs. lineage-specific residues

    • Create a fingerprint of diagnostic residues using PIPSA analysis

  • Residue conservation mapping:

    • Map conservation scores onto structural models

    • Identify surface patches with high conservation

    • Distinguish between conserved core and variable surface regions

  • Coevolution analysis:

    • Detect coevolving residue networks

    • Identify functional coupling between residues

    • Predict allosteric networks within the protein

Results from computational analyses should guide experimental design, including targeted mutagenesis of high-priority residues identified through conservation analysis and simulations.

What are the critical parameters for optimizing recombinant Guillardia theta petD protein yield and purity?

Optimizing yield and purity of recombinant membrane proteins requires systematic optimization of multiple parameters:

Expression optimization:

  • Induction conditions:

    • Test multiple inducer concentrations (e.g., 0.1-1.0 mM IPTG)

    • Evaluate different induction temperatures (16-37°C)

    • Optimize induction duration (4-24 hours)

  • Media optimization:

    • Compare defined media vs. complex media

    • Test auto-induction formulations

    • Supplement with membrane protein-specific additives (glycerol, sorbitol)

  • Host strain selection:

    • C41(DE3)/C43(DE3) for toxic membrane proteins

    • BL21(DE3)pLysS for tighter expression control

    • Rosetta strains for rare codon optimization

Purification optimization:

  • Detergent screening:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Systematic testing of detergent types and concentrations

    • Consider detergent exchange during purification

  • Chromatography strategy:

    • Optimize bind-wash-elute conditions for affinity steps

    • Implement orthogonal purification steps

    • Consider on-column detergent exchange

  • Stability enhancement:

    • Screen buffer components (pH, salt, additives)

    • Include lipids or lipid-like molecules

    • Optimize protein concentration to prevent aggregation

Optimization results tracking table:

ParameterTested rangeOptimal conditionEffect on yieldEffect on purity
IPTG concentration0.1-1.0 mM0.3 mM3-fold increaseMinimal effect
Temperature16-37°C18°C2-fold increaseSignificant improvement
Induction time4-24h16hModerate increaseModerate improvement
DetergentDDM, LMNG, LDAODDM 1%Critical for extractionCritical for stability
Buffer pH6.0-8.57.5Moderate effectSignificant for stability
Salt concentration100-500 mM300 mM NaClModerate increaseReduces aggregation

How should researchers design experiments to investigate the assembly of recombinant Guillardia theta petD into functional cytochrome b6-f complexes?

Investigating complex assembly requires careful experimental design:

Co-expression strategies:

  • Multi-protein expression systems:

    • Design polycistronic constructs for coordinated expression

    • Employ dual-vector systems with compatible origins and selection markers

    • Optimize expression ratios through promoter strength variation

  • Sequential purification approaches:

    • Design orthogonal affinity tags for different subunits

    • Implement tandem affinity purification

    • Verify complex formation via size exclusion chromatography

Assembly validation methods:

  • Analytical techniques:

    • Blue native PAGE to visualize intact complexes

    • Analytical ultracentrifugation to determine complex stoichiometry

    • Mass photometry for single-molecule complex analysis

  • Functional characterization:

    • Electron transfer assays using artificial electron donors/acceptors

    • Proton pumping assays in reconstituted proteoliposomes

    • Spectroscopic characterization of assembled complexes

  • Structural verification:

    • Negative-stain electron microscopy for complex visualization

    • Crosslinking mass spectrometry to map subunit interfaces

    • Single-particle cryo-EM for complex structure determination

Implementation workflow:

  • Begin with individual expression and purification optimization

  • Progress to co-expression of subunit pairs (petD with cytochrome b6)

  • Expand to larger sub-complexes

  • Attempt complete complex reconstitution

  • Validate structure and function using complementary methods

What techniques are most effective for analyzing the interaction between recombinant petD and other components of the cytochrome b6-f complex?

Understanding protein-protein interactions within the cytochrome b6-f complex requires multiple complementary techniques:

In vitro interaction analysis:

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interactions in complex solutions

  • Structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Chemical crosslinking followed by MS identification of crosslinked peptides

    • FRET-based assays for proximity detection between labeled components

  • Biochemical methods:

    • Co-immunoprecipitation with antibodies against specific subunits

    • Pull-down assays using affinity-tagged components

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

In vivo interaction validation:

  • Genetic approaches:

    • Bacterial/yeast two-hybrid systems

    • Split-GFP complementation

    • Protein-fragment complementation assays

  • Microscopy methods:

    • Förster resonance energy transfer (FRET) microscopy

    • Bimolecular fluorescence complementation

    • Co-localization studies using differentially labeled proteins

Data analysis approaches:

  • Interaction kinetics analysis:

    • Determine association/dissociation rate constants (kon/koff)

    • Calculate equilibrium dissociation constants (KD)

    • Compare affinities under different experimental conditions

  • Modeling validation:

    • Compare experimental interaction data with computational predictions

    • Refine structural models based on interaction constraints

    • Identify specific residues critical for complex formation

How can researchers overcome challenges in obtaining structural data for Guillardia theta petD?

Structural characterization of membrane proteins presents unique challenges:

Crystallization alternatives:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for larger complexes

    • Optimize sample preparation (detergent selection, grid conditions)

    • Consider antibody fragment complexes for size enhancement

  • NMR approaches:

    • Solution NMR for smaller domains

    • Solid-state NMR for membrane-embedded regions

    • Selective isotope labeling to simplify spectra

  • Alternative crystallography methods:

    • Lipidic cubic phase crystallization

    • Antibody-mediated crystallization

    • Crystallization with stabilizing fusion partners

Sample preparation strategies:

  • Protein engineering:

    • Remove flexible regions

    • Introduce thermostabilizing mutations

    • Create fusion constructs with well-behaved proteins

  • Stabilization techniques:

    • Nanodiscs or amphipols as detergent alternatives

    • Lipid-protein nanodiscs for native-like environment

    • Conformation-specific antibodies or nanobodies

  • Hybrid approaches:

    • Integrate lower-resolution EM data with computational models

    • Combine solution NMR with distance constraints from other methods

    • Validate models with crosslinking and mass spectrometry data

The high abundance of properly folded recombinant protein that can be achieved with optimized expression systems significantly improves chances of structural determination . Successful structural biology projects often require testing multiple constructs and conditions systematically.

What emerging technologies hold promise for advancing research on recombinant Guillardia theta cytochrome b6-f complex proteins?

Several cutting-edge technologies are poised to transform research on membrane protein complexes like cytochrome b6-f:

Advanced structural methods:

  • Cryo-electron tomography:

    • Visualize protein complexes in their native membrane environment

    • Study spatial organization and interactions within thylakoid membranes

    • Combine with subtomogram averaging for higher resolution

  • Integrative structural biology:

    • Combine data from multiple experimental techniques

    • Implement computational methods to integrate diverse constraints

    • Develop models that capture dynamic aspects of complex assembly

  • Time-resolved structural methods:

    • X-ray free-electron laser (XFEL) for capturing transient states

    • Time-resolved cryo-EM to visualize conformational changes

    • Ultra-fast spectroscopy coupled with structural analysis

Functional characterization advances:

  • Single-molecule techniques:

    • Optical tweezers to measure mechanical properties

    • Single-molecule FRET to track conformational dynamics

    • Nanopore-based electrical recordings of individual complexes

  • In-cell methods:

    • Advances in genetic code expansion for in vivo structural biology

    • Improved methods for in-cell NMR and EPR

    • Correlative light and electron microscopy approaches

  • Artificial intelligence applications:

    • Enhanced protein structure prediction (building on AlphaFold advances)

    • Machine learning for functional annotation

    • AI-guided protein engineering for improved stability

These emerging technologies will allow researchers to move beyond static structural models toward a dynamic understanding of how cytochrome b6-f complexes function in their native environment.

How might understanding of recombinant petD expression contribute to broader research on photosynthetic efficiency and synthetic biology applications?

Research on recombinant petD has implications that extend beyond basic understanding:

Applications in photosynthesis research:

  • Engineering improved photosynthetic efficiency:

    • Modify electron transport components for enhanced performance

    • Optimize cytochrome b6-f complex for altered environmental conditions

    • Create synthetic variants with improved kinetic properties

  • Understanding evolutionary adaptations:

    • Compare nuclear-encoded versus chloroplast-encoded petD performance

    • Investigate how gene migration affects regulation and efficiency

    • Study how secondary endosymbiosis shaped complex evolution

  • Climate adaptation mechanisms:

    • Explore how cytochrome b6-f complexes from different organisms adapt to temperature

    • Study regulatory mechanisms controlling electron transport under stress

    • Identify critical adaptations for maintaining function in changing environments

Synthetic biology applications:

  • Bioenergy production:

    • Engineer optimized electron transport chains for biofuel production

    • Design artificial photosynthetic systems with enhanced efficiency

    • Create minimal synthetic systems for specialized applications

  • Biosensor development:

    • Utilize electron transport components as redox-sensitive biosensors

    • Develop systems to detect environmental pollutants affecting photosynthesis

    • Create diagnostic tools for monitoring photosynthetic health

  • Teaching and research tools:

    • Develop simplified systems for teaching photosynthesis principles

    • Create standardized components for photosynthesis research

    • Establish model systems for studying evolutionary processes

The insights gained from successfully expressing and characterizing recombinant cytochrome b6-f complex components will contribute to both fundamental understanding and practical applications in biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.