Recombinant Guillardia theta Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

This protein is produced in two primary systems:

Expression SystemTagPurityProduct Code
E. coliN-terminal 10xHis>85%CSB-CF524944GHG
BaculovirusUndetermined>85%CSB-BP524944GHG1

Lyophilized formulations require reconstitution in Tris/PBS-based buffers with glycerol (5–50%) for stability .

Functional Role in Photosynthesis

Cytochrome b6 (petB) is a core subunit of the cytochrome b₆f complex, which mediates:

  • Linear electron transport: Transfers electrons from Photosystem II to Photosystem I .

  • Cyclic electron transport: Supports ATP synthesis independently of Photosystem II .

  • Complex assembly: Requires interaction with other subunits (e.g., cytochrome f, PetM, PetN/ycf6) for structural stability .

Deletion of associated genes (e.g., ycf6) abolishes cytochrome b₆f complex assembly, leading to photosynthetic failure .

Research Applications

Recombinant petB is utilized in:

  • Structural studies: Mapping transmembrane helices and redox centers .

  • Functional assays: Testing electron transport kinetics in mutant algal strains .

  • Antibody production: Immunoblotting to quantify cytochrome b₆f complex levels .

Evolutionary Significance

In Guillardia theta, petB is co-transcribed with petM—a gene nuclear-encoded in higher plants—highlighting evolutionary divergence in photosynthetic gene regulation . This operon structure is conserved in red algae (e.g., Porphyra purpurea) but lost in land plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCIGGITFTCFIIQVATGFAMTFYYRP TVAEAFASVEYIMTEVNYGWLFRSMHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVTLAVVTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPVVGSLLVELLRGSVSVGQATL TRFYSAHTFVLPVAAAVLMLTHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the composition of the cytochrome b6f complex in Guillardia theta and how does PetB fit into this structure?

The cytochrome b6f complex in G. theta, like in other photosynthetic organisms, is a multi-subunit protein complex embedded in the thylakoid membrane. The complex serves as a crucial electron transport intermediary between photosystems II and I. Based on research findings, the cytochrome b6f complex consists of several essential subunits including:

  • Cytochrome b6 (PetB) - the focus of this FAQ

  • Cytochrome f (PetA)

  • Rieske iron-sulfur protein (PetC)

  • Subunit IV (PetD)

  • Several small subunits including PetG, PetL, PetM, and PetN (formerly Ycf6)

Cytochrome b6 (PetB) forms the core of the complex and contains multiple transmembrane helices and several heme groups that are essential for electron transport. The PetB protein works in concert with cytochrome f, which has been shown to be "a key component of the cytochrome b6f complex and is known to be essential for both electron transfer and complex assembly" . When any key component is absent, the entire complex becomes unstable and is rapidly degraded .

How does the absence of functional cytochrome b6f complex affect photosynthesis in G. theta?

The absence of a functional cytochrome b6f complex creates a complete block in photosynthetic electron transport. Research has demonstrated that when the complex is non-functional, electron transfer from Photosystem II to Photosystem I is prevented, resulting in:

  • Complete loss of photosynthetic activity

  • Normal accumulation of both photosystems, but inability to transfer electrons between them

  • Retention of the ability to perform isolated photochemical reactions within each photosystem

  • Normal accumulation of plastocyanin (the electron carrier between cytochrome b6f and PSI)

  • Normal accumulation of ATP synthase components

These findings, derived from studies of mutants lacking essential components of the complex, confirm that "the mutant phenotype... is due to the absence of electron transfer from PSII to PSI. Moreover, they strongly suggest that this block in electron transport is caused by the lack of functional cytochrome b6f complex" .

What are the key differences between G. theta cytochrome b6 and those found in higher plants or cyanobacteria?

G. theta, as a cryptophyte alga, occupies an interesting evolutionary position, having acquired photosynthetic capability through secondary endosymbiosis of a red alga. This evolutionary history creates several distinctive features in its cytochrome b6 organization:

FeatureG. thetaHigher PlantsCyanobacteria
Genome locationNuclearChloroplastBacterial genome
Genomic organizationLikely unlinked from other photosynthesis genesPart of plastid genomeOften organized in operons
Post-translational modificationsComplex targeting mechanismsSimpler targetingSimple targeting
Operon structureCo-expression patterns differ from ancient patternsUnlinked expressionOften co-expressed with related components

While the core function remains conserved across these diverse organisms, the genomic organization and regulation show important differences reflecting the complex evolutionary history of G. theta. The cryptophyte has undergone significant genomic reorganization, with some genes transferred to the nucleus and others maintained in the nucleomorph or plastid genomes .

What expression systems are most suitable for producing recombinant G. theta PetB protein?

Producing functional recombinant cytochrome b6 from G. theta presents several technical challenges due to its hydrophobic nature and requirement for proper cofactor insertion. Based on research methodologies for similar proteins, the following expression systems should be considered:

Expression SystemAdvantagesDisadvantagesSpecial Considerations
E. coliHigh yield, ease of manipulationLacks eukaryotic PTMs, inclusion body formation commonRequires fusion tags, specialized strains, and optimized protocols for membrane proteins
Yeast (P. pastoris)Eukaryotic PTMs, good for membrane proteinsLower yields than E. coliBetter folding of complex proteins
Insect cell/BaculovirusExcellent for eukaryotic membrane proteinsHigher cost, longer timeMay provide better folding environment
Cell-free systemsAvoid toxicity issues, direct access for cofactor additionLower yields, higher costAllows incorporation of labeled amino acids for structural studies

For successful expression, researchers should consider using codon-optimized sequences, fusion tags to improve solubility (such as maltose-binding protein or SUMO), and expression conditions that reduce toxicity. Low-temperature induction (16-18°C) often improves folding of membrane proteins like PetB. Additionally, co-expression with chaperones may improve yield of correctly folded protein.

When expressing PetB, it's crucial to consider the challenge of heme incorporation, as proper integration of cofactors is essential for function. Based on analogous research with PBP-lyases from G. theta that "facilitate the attachment of the chromophore in the right configuration and stereochemistry" , similar attention must be paid to proper cofactor assembly in recombinant PetB.

What purification approaches maintain the structural integrity of recombinant PetB?

Purification of recombinant PetB requires careful selection of techniques that preserve its native structure. Based on methodologies for similar membrane proteins:

  • Membrane isolation and solubilization:

    • Gentle lysis methods (French press or sonication with protease inhibitors)

    • Selective membrane isolation through differential centrifugation

    • Careful detergent selection (typically DDM, LMNG, or digitonin) at concentrations above CMC but below levels that disrupt protein-protein interactions

  • Chromatography techniques:

    • Immobilized metal affinity chromatography (IMAC) when His-tags are used

    • Size exclusion chromatography to separate properly assembled complexes

    • Ion exchange chromatography as needed for further purification

  • Verification methods:

    • Western blotting can confirm identity (similar to techniques used with anti-PetD antibodies)

    • Absorption spectroscopy to verify heme incorporation

    • Mass spectrometry for intact protein analysis

A critical factor when purifying recombinant PetB is maintaining conditions that preserve cofactor association. Based on research with G. theta proteins, "binding of phycobilins with a reduced C15,C16-bond" demonstrates the importance of redox conditions during purification. Similarly, for PetB, maintaining appropriate redox conditions to preserve heme groups is essential.

How can researchers assess the proper folding and cofactor integration of recombinant PetB?

Confirming proper folding and cofactor integration is crucial for ensuring that recombinant PetB maintains native functionality. Several complementary techniques should be employed:

  • Spectroscopic methods:

    • UV-visible absorption spectroscopy to verify characteristic heme absorption peaks

    • Circular dichroism (CD) to assess secondary structure

    • Fluorescence spectroscopy to monitor tertiary structure and cofactor environment

  • Functional assays:

    • Electron transfer capacity using artificial electron donors/acceptors

    • Redox potential measurements using potentiometric titration

    • Binding assays with known interaction partners

  • Structural verification:

    • Limited proteolysis to assess folding status

    • Thermal shift assays to determine stability

    • Analytical ultracentrifugation to evaluate oligomeric state

Research with G. theta PBP-lyases demonstrates how spectral characteristics can verify proper chromophore integration: "the absorbance maximum of PEB is red shifted from 535 nm to 598 nm with a significant increase in intensity with a shoulder at 557 nm" . Similar spectral signatures should be identified for properly folded PetB with correctly incorporated heme groups.

What experimental approaches are effective for studying electron transport function of recombinant PetB?

Studying the electron transport function of recombinant PetB requires techniques that can measure redox activities at both biochemical and biophysical levels:

  • In vitro electron transport assays:

    • Oxygen consumption/evolution measurements

    • Artificial electron donor/acceptor coupling assays

    • Cytochrome c reduction assays (measuring electron transfer capacity)

  • Biophysical techniques:

    • Flash photolysis to measure electron transfer kinetics

    • EPR spectroscopy to characterize redox-active centers

    • Time-resolved fluorescence to monitor energy transfer events

  • Reconstitution approaches:

    • Liposome reconstitution to create a membrane environment

    • Co-reconstitution with interaction partners

    • Nanodiscs for stabilized membrane protein studies

Research on mutants lacking components of the cytochrome b6f complex has employed "various fluorescence parameters [to measure] the activity of both photosystems" . Similar approaches can be adapted for assessing recombinant PetB function. When measuring activity, it's important to include controls that can distinguish between specific electron transport and non-specific reactions.

How does the gene organization of petB differ between G. theta and other photosynthetic organisms?

The genomic organization of photosynthetic genes in G. theta reflects its complex evolutionary history through secondary endosymbiosis. Key differences in petB organization include:

  • Genomic location variations:

    • In higher plants, petB is chloroplast-encoded

    • In G. theta, the location may differ due to gene transfer events

    • In cyanobacteria, petB is typically found in photosynthetic operons

  • Regulatory elements:

    • Different promoter structures between cryptophytes and other photosynthetic organisms

    • Altered intron patterns reflecting evolutionary divergence

    • Species-specific regulatory sequences

  • Co-expressed gene clusters:

    • In cyanobacteria and red algae, photosynthetic genes are often co-transcribed

    • In cryptophytes like G. theta, "co-transcription of the two reading frames indicates their tightly coordinated expression" for some photosynthetic genes

    • Gene rearrangements during evolution have separated previously linked genes

Research on G. theta has revealed interesting evolutionary patterns: "Whereas the ycf6 reading frame is unlinked to other photosynthesis genes in higher plant chloroplast genomes, it is part of an operon in the plastid genomes of the rhodophyte alga Porphyra purpurea and the cryptophyte alga Guillardia theta" . This suggests that gene organization in G. theta represents intermediate evolutionary states between ancestral patterns and the more derived arrangements in higher plants.

What phylogenetic insights can be gained from studying G. theta cytochrome b6 compared to homologs from other organisms?

Cytochrome b6 sequences provide valuable information for understanding the evolutionary history of photosynthetic organisms:

  • Evolutionary transitions:

    • G. theta represents a key intermediate in understanding the evolution of photosynthesis through endosymbiosis

    • Sequence comparisons can reveal selective pressures on electron transport components

    • Conserved vs. variable regions highlight functional constraints

  • Horizontal gene transfer detection:

    • Unusual sequence similarities may indicate horizontal gene transfer events

    • Gene arrangement comparisons can reveal genomic restructuring during evolution

    • Regulatory element evolution can be traced through comparative genomics

  • Adaptation signatures:

    • Amino acid substitutions unique to cryptophytes may indicate adaptation to specific light environments

    • Coevolution patterns with interaction partners

    • Selection pressure differences between nuclear and plastid-encoded components

The research on G. theta photosynthetic genes demonstrates how evolutionary insights can be gained: "In contrast, petM is a nuclear gene in higher plants indicating that, in the course of evolution, the gene was transferred to the nucleus and novel regulatory mechanisms have replaced the ancestral coordinated expression" . Similar analyses with cytochrome b6 can reveal important evolutionary transitions.

How can site-directed mutagenesis of recombinant PetB inform our understanding of electron transport mechanisms?

Site-directed mutagenesis of recombinant PetB provides a powerful approach to dissect specific functional regions and mechanisms:

  • Key target residues for mutagenesis:

    • Heme-binding residues to assess cofactor requirements

    • Transmembrane helices to evaluate structural requirements

    • Conserved charged residues potentially involved in proton transport

    • Interface residues that contact other complex subunits

  • Functional impacts to evaluate:

    • Effects on electron transfer rates

    • Complex assembly efficiency

    • Proton coupling mechanisms

    • Redox potential alterations

  • Experimental design considerations:

    • Generate multiple mutation types (conservative vs. non-conservative substitutions)

    • Combine with structural analysis techniques

    • Use complementary in vitro and in vivo approaches

Research on G. theta CPES lyase demonstrates how mutagenesis approaches can provide mechanistic insights: "The most important residue for PEB transfer is a tryptophan located at the upper rim of the barrel. Variant W75A, although still being able to bind PEB like the wt lyase, is not able to facilitate the transfer of PEB" . Similar mutation-function relationships can be established for PetB, identifying critical residues for each aspect of its function.

What approaches can be used to study the assembly of recombinant PetB into functional cytochrome b6f complexes?

Understanding the assembly pathway of cytochrome b6f complexes is crucial for both basic science and biotechnological applications:

  • Co-expression strategies:

    • Simultaneous expression of multiple complex components

    • Sequential addition of components to identify assembly order

    • Cell-free systems allowing controlled assembly conditions

  • Assembly intermediates characterization:

    • Blue native PAGE to resolve assembly intermediates

    • Mass spectrometry of partially assembled complexes

    • Cryo-EM of assembly states

  • Chaperone identification:

    • Pull-down assays to identify assembly factors

    • Genetic screens for assembly mutants

    • In vitro reconstitution with candidate chaperones

Research on cytochrome b6f complex assembly indicates that "When cytochrome f is not synthesized or not targeted to the thylakoid membrane, all other subunits of the complex are highly unstable and rapidly degraded" . This suggests a sequential assembly process that can be studied using recombinant components. Additionally, the finding that "the Ycf6 protein is a genuine subunit of the cytochrome b6f complex" indicates that previously unknown factors may be involved in complex assembly.

How can structural data from recombinant PetB inform the design of artificial photosynthetic systems?

Structural insights from recombinant PetB can guide the development of biomimetic and artificial photosynthetic systems:

  • Critical design elements:

    • Spatial arrangement of electron transfer cofactors

    • Protein-cofactor interaction patterns

    • Proton transfer pathways

    • Membrane integration requirements

  • Biomimetic approaches:

    • Minimal functional units definition

    • Essential vs. non-essential structural features

    • Optimization possibilities through protein engineering

    • Integration with artificial light-harvesting systems

  • Translational applications:

    • Design principles for synthetic biology applications

    • Solar energy conversion optimization

    • Metabolic engineering considerations

Research on G. theta PBP-lyases demonstrates how structural insights can inform functional understanding: "Based on the previously solved crystal structure, the Gt[CPES] binds PEB and 15,16-DHBV with high affinity" . Similar structure-function relationships derived from recombinant PetB studies can inform artificial system design. The finding that "the Ycf6/PetN protein is a crucial factor for cytochrome b6f complex assembly and/or stability" highlights how even small components can be critical for function - an important consideration for artificial system design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.