Recombinant Guillardia theta Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction

Photosystem I (PSI) is a large multi-protein complex found in thylakoid membranes, essential for oxygenic photosynthesis . The assembly of PSI requires various auxiliary proteins, including Ycf4 . Ycf4 is a conserved chloroplast-encoded factor that forms modules to mediate PSI assembly . It is localized in the thylakoid membranes, where it participates in post-translational steps of PSI assembly .

Function of Ycf4

Ycf4 is crucial for the accumulation of PSI complexes . It is believed to function in the integration of peripheral PSI subunits and light-harvesting complexes (LHCIs) into the PSI reaction center subcomplex . Biochemical studies have shown that Ycf4 exists within a large complex, exceeding 1500 kD, containing a retinal-binding protein (COP2) and several PSI polypeptides, suggesting its role in assembling an intermediate subcomplex .

Interaction with Other Proteins

Ycf4 interacts with other auxiliary factors, such as Ycf3 and Y3IP1, to form a core PSI assembly apparatus . The module consisting of Ycf3 and Y3IP1 primarily facilitates the assembly of reaction center subunits, while Ycf4 facilitates the integration of peripheral PSI subunits and LHCIs into the PSI reaction center subcomplex .

4.1. Purification and Identification of Ycf4-Containing Complexes

To investigate the biochemical properties of Ycf4, researchers have purified Ycf4-containing complexes using tandem affinity purification (TAP) tags . This process involves a two-step affinity column chromatography. The TAP-tag consists of a calmodulin-binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site .

4.2. Generation of TAP-Tagged Ycf4 Strain

To generate a TAP-tagged Ycf4 strain in C. reinhardtii, the ycf4 gene was tagged with a TAP-tag sequence. The resulting transformants were screened for the presence of the TAP-tag by PCR. The generated TAP-tag strain was confirmed to be homoplasmic, with the wild-type chloroplast DNA copies totally replaced by the tagged copies via homologous recombination .

4.3. Phenotypic Analysis of TAP-Tagged Ycf4 Strain

The TAP-tagged strain exhibited wild-type-like PSI complex assembly, indicating that the fusion of the TAP-tag did not affect the assembly and stability of the PSI complex . Fluorescence induction kinetics confirmed that the TAP-tagged strain displayed PSI activity. The TAP-tagged strain grew photoautotrophically, similar to the wild type and control strains .

4.4. Interaction of Ycf3 and Ycf4

Affinity purification of HA-tagged Ycf3 (ycf3-HA) from solubilized thylakoid membranes, followed by characterization of interacting proteins, revealed that Ycf3 and Ycf4 form modules that mediate PSI assembly. Immunoblotting revealed that PsaA and Ycf4 were also present in the Y3IP1-HA preparation .

Role of Ycf4 in PSI Assembly

  • Assembly of Reaction Center Subunits: Ycf4, along with Ycf3 and Y3IP1, assists in the assembly of reaction center subunits .

  • Integration of Peripheral Subunits: Ycf4 facilitates the integration of peripheral PSI subunits and LHCIs into the PSI reaction center subcomplex .

  • Post-translational Modification: Ycf4 is involved in the post-translational steps of PSI assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
ycf4
Target Protein Sequence
MNTKIRTDLILGSKRFSNYAWCFILMTGGIGFCLTGVGSYFNLHTILFVKFSDINFIPQG IVMMFYGTIAILFSLFLMYSIFTDVGGGYNKYDKEKKEIEIFRLGYNKKNKQMLLKYNFR DIKSIKIELKDDINPKREIYLVTKNKNQIPLTRIGEPLLLSDVENQAIELANFLNIPIEG I
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Guillardia theta Photosystem I assembly protein Ycf4 and what is its role in photosynthesis?

Guillardia theta Photosystem I assembly protein Ycf4 is a thylakoid protein essential for the accumulation and assembly of photosystem I (PSI) complexes. Ycf4 functions as a critical assembly factor that mediates interactions between newly synthesized PSI polypeptides and assists in the assembly of the PSI complex, playing a pivotal role in the initial assembly steps . Studies have demonstrated that Ycf4 is part of a large complex (>1500 kD) that contains other proteins including the opsin-related COP2 and several PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) . This protein-complex association suggests that Ycf4 serves as a molecular scaffold during PSI assembly.

While some organisms like cyanobacteria can still assemble PSI complexes at reduced levels without Ycf4, research with complete gene knockouts in tobacco has demonstrated that YCF4 is actually essential for photosynthesis and photoautotrophic growth . Plants with complete YCF4 deletion cannot survive without an external carbon supply, indicating its critical functional importance beyond what was previously understood .

How should recombinant Guillardia theta Ycf4 protein be stored and handled in laboratory settings?

Proper storage and handling of recombinant Guillardia theta Ycf4 protein is critical for maintaining its stability and function. Based on manufacturer recommendations, the following protocol should be implemented:

Reconstitution Procedure:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (manufacturer default is 50%)

  • Aliquot for long-term storage

Storage Conditions:

  • Lyophilized form: 12 months shelf life at -20°C/-80°C

  • Liquid form: 6 months shelf life at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

Important Handling Notes:

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein stability

  • The shelf life depends on multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself

What are the biochemical characteristics of recombinant Guillardia theta Ycf4?

Recombinant Guillardia theta Photosystem I assembly protein Ycf4 (product code CSB-EP529260GHG1) has the following biochemical specifications:

ParameterSpecification
SourceE. coli expression system
Purity>85% (determined by SDS-PAGE)
UniProt AccessionO78467
Alternative NameCryptomonas phi
Protein LengthPartial
Tag InformationVariable (determined during manufacturing)

The protein is produced using recombinant technology in E. coli, allowing for consistent production of functional protein with high purity . The partial length indicates that the recombinant protein may not represent the complete native sequence but contains the functionally important domains.

What experimental approaches have been employed to study Ycf4's role in PSI assembly?

Researchers have utilized multiple sophisticated experimental approaches to elucidate Ycf4's role in PSI assembly:

Tandem Affinity Purification (TAP) Tagging:
The TAP-tag approach has been successfully implemented to purify and characterize Ycf4-containing complexes. This technique involves:

  • Creating fusion proteins with calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site

  • Two-step affinity column chromatography for high-purity isolation

  • Verification of complex integrity through immunoblotting and functional assays

Mass Spectrometry Analysis:
Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been employed to identify components of the Ycf4 complex, revealing its association with COP2 and PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF .

Electron Microscopy and Single Particle Analysis:
This technique has been utilized to visualize the structure of purified Ycf4-containing complexes, revealing particles measuring approximately 285 × 185 Å that may represent several large oligomeric states .

Pulse-Chase Protein Labeling:
This method has demonstrated that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled, supporting Ycf4's role in the early stages of PSI assembly .

Complete Gene Knockout:
Complete deletion of the YCF4 gene has revealed its essential nature for photosynthesis, contradicting earlier studies using partial knockouts that concluded it was non-essential .

How do mutations in specific domains of Ycf4 affect protein stability and function?

Site-directed mutagenesis studies have provided valuable insights into the structural requirements for Ycf4 stability and function. Particularly, mutations in the R120 residue have demonstrated significant effects:

R120 Mutations and Protein Stability:

  • R120A and R120Q mutations result in Ycf4 accumulation at only 20% of wild-type levels in logarithmic growth phase

  • These mutant cells in stationary growth phase accumulate almost no Ycf4

  • Chloramphenicol treatment experiments revealed significantly higher instability of mutant Ycf4 compared to wild-type protein

  • These findings conclusively demonstrate that R120 is required for Ycf4 stability

Effects on PSI Complex:
Despite reduced Ycf4 levels in R120 mutants, the PSI reaction center protein PsaA accumulated at wild-type levels, suggesting complex compensatory mechanisms in PSI assembly .

These mutation studies highlight the importance of specific conserved residues in maintaining protein stability while also revealing the robustness of the PSI assembly process in certain conditions.

What molecular interactions have been identified between Ycf4 and other photosynthetic proteins?

Molecular docking studies and experimental approaches have revealed extensive interaction networks between Ycf4 and other photosynthetic proteins:

Interactions with PSI Subunits:

  • Strong interactions with psaB, psaC, and psaH, each forming seven hydrogen bonds with Ycf4

  • The Ycf4-psaC complex shows particularly stable interaction with bond lengths of 2.62-2.93Å

  • Interaction with psaE through five hydrogen bonds

Interactions with ATP Synthase:

  • The beta chain (atpB) demonstrates effective docking with Ycf4, forming twelve hydrogen bonds with bond lengths of 2.56-3.15Å

Interactions with Ribosomal Components:

  • rrn16 shows strong affinity with Ycf4, forming ten hydrogen bonds within the bond length range of 2.63-3.19Å

Interactions with Other Plastidic Proteins:

  • Maximum binding affinity observed with rbcL among candidate proteins

  • rpoB interacts extensively with truncated versions of Ycf4, forming nine bonds with the amino terminus and twenty-five bonds with the carboxyl terminus

Importance of C-terminus:
Molecular docking studies comparing full-length YCF4 with truncated versions demonstrated that the C-terminus (91 amino acids) exhibits stronger interaction patterns with photosynthetic proteins than the N-terminus (93 amino acids), suggesting functional specialization within the protein structure .

What structural features of Ycf4 are crucial for its proper function in PSI assembly?

Several structural features have been identified as critical for Ycf4's function in PSI assembly:

C-Terminal Domain:
The C-terminal portion (91 amino acids) of Ycf4 plays a particularly important role in protein-protein interactions. Molecular docking studies have demonstrated that this region forms more extensive hydrogen bonding networks with photosynthetic proteins than the N-terminal region .

Conserved Residues:
The R120 residue has been identified as crucial for protein stability. Mutations at this position (R120A and R120Q) significantly destabilize the protein, suggesting its importance in maintaining proper folding or preventing degradation .

Oligomeric Structure:
Electron microscopy has revealed that Ycf4-containing complexes form large structures measuring approximately 285 × 185 Å, indicating that proper oligomerization may be essential for function .

Interaction Domains:
The specific domains responsible for interaction with COP2 and various PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) are critical for the protein's assembly function. These interaction regions provide binding sites for newly synthesized PSI components during the assembly process .

How does experimental evidence from different Ycf4 knockout approaches challenge previous understanding?

Contrasting findings from different knockout approaches have significantly revised our understanding of Ycf4's essentiality:

Partial vs. Complete Knockout Results:

  • Previous research utilizing incomplete knockout of YCF4 (removing only 93 of 184 amino acids from the N-terminus) concluded that Ycf4 was a non-essential assembly factor for photosynthesis

  • More recent studies employing complete deletion of the YCF4 gene demonstrated that plants lacking Ycf4 could not survive photoautotrophically and required external carbon supply

Phenotypic Differences:

  • Complete ΔYCF4 plants exhibited a light green phenotype initially

  • Leaves became progressively pale yellow as plants aged

  • Transmission electron microscopy revealed structural anomalies in chloroplasts including altered shape, size, and grana stacking compared to wild-type plants

Transcriptional Effects:
Transcriptome analysis of complete ΔYCF4 plants revealed:

  • Unchanged expression of PSI, PSII, and ribosomal genes

  • Decreased transcription of rbcL (Ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit)

  • Reduced expression of LHC (Light-Harvesting Complex) genes

  • Decreased transcription of ATP Synthase genes (atpB and atpL)

These findings suggest that Ycf4 serves functions beyond PSI assembly, potentially including roles in regulating plastid gene expression.

What are the optimal purification methods for isolating Ycf4-containing complexes?

Successful isolation of Ycf4-containing complexes requires careful optimization of purification protocols:

Tandem Affinity Purification Protocol:

  • Generation of TAP-tagged Ycf4 through genetic transformation

  • Verification of TAP-tag functionality through immunoblotting and phenotypic analysis

  • Solubilization of thylakoid membranes with dodecyl maltoside (DDM)

  • First affinity step: Binding to IgG agarose (overnight incubation at 4°C in a rotating column for maximum adsorption)

  • TEV protease digestion to cleave the protein A domain

  • Second affinity step: Calmodulin affinity purification

  • Elution and analysis of purified complexes

Critical Optimization Factors:

  • Extended incubation times with IgG agarose (overnight at 4°C) are required for efficient adsorption of the TAP-tagged Ycf4

  • Approximately 90% of Ycf4 can be adsorbed to IgG agarose under optimal conditions

  • Careful verification that the TAP-tag does not interfere with Ycf4 function is essential before proceeding with complex purification

  • Fluorescence induction kinetics of dark-adapted cells and photoautotrophic growth assays can confirm functional integrity

What analytical techniques are most effective for characterizing Ycf4-protein interactions?

Multiple complementary techniques have proven effective for characterizing Ycf4-protein interactions:

Computational Approaches:

  • Molecular docking using ClusPro 2.0 predicts interactions through rigid-body docking based on Fast Fourier Transform

  • DIMPLOT program of Ligplot+ v.4.5.3 identifies hydrogen bonds and bond lengths between interacting residues

  • Optimal interaction is characterized by high numbers of hydrogen bonds with bond lengths <4Å

Experimental Approaches:

  • Mass spectrometry (LC-MS/MS) for identifying complex components

  • Immunoblotting with specific antibodies to confirm the presence of interacting partners

  • Pulse-chase protein labeling to examine temporal dynamics of protein interactions

  • Electron microscopy and single particle analysis for structural characterization

  • Sucrose gradient ultracentrifugation and ion exchange column chromatography to verify protein associations

Validation Through Functional Studies:

  • Site-directed mutagenesis targeting key residues identified in docking studies

  • Analysis of mutant phenotypes and protein accumulation levels

  • Assessment of PSI assembly and function in mutant backgrounds

What are the key unanswered questions regarding Guillardia theta Ycf4 function?

Despite significant advances in understanding Ycf4 function, several important questions remain:

  • Regulatory Mechanisms: How is Ycf4 expression and activity regulated in response to environmental conditions and developmental stages?

  • Species-Specific Functions: How do the functions of Ycf4 differ between Guillardia theta and other photosynthetic organisms, particularly considering evolutionary distance?

  • Non-Assembly Roles: What are the precise mechanisms by which Ycf4 influences transcription of genes like rbcL, LHC, and ATP Synthase genes?

  • Structural Determination: What is the high-resolution structure of Guillardia theta Ycf4, and how does this structure enable its function?

  • Complex Dynamics: What is the temporal sequence of interactions between Ycf4 and PSI components during assembly, and how are these interactions coordinated?

What methodological approaches might advance Ycf4 research?

Future research on Guillardia theta Ycf4 could benefit from several advanced methodological approaches:

Cryo-Electron Microscopy:
High-resolution structural determination of the entire Ycf4-containing complex would provide invaluable insights into its assembly mechanism.

Time-Resolved Proteomics:
Analyzing the temporal dynamics of Ycf4-containing complexes during PSI assembly could reveal the sequence of assembly events.

Comparative Genomics and Systems Biology:
Comprehensive analysis of Ycf4 across diverse photosynthetic organisms could identify conserved functional domains and species-specific adaptations.

Synthetic Biology Approaches:
Creating chimeric Ycf4 proteins with domains from different species could help determine the functional significance of specific regions.

In vivo Imaging Techniques: Developing methods to visualize Ycf4-PSI interactions in living cells would provide dynamic information about assembly processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.