Recombinant Guillardia theta Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
psaF; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-183
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
psaF
Target Protein Sequence
HADVAGLVPCKNSKEFQRRLDSSVKKLESRLSKYEPNTPPYLALETQINKTKNRFTQYGN AGLLCGTDGLPHLIADGRWSHAGEFMVPGLFFLYIAGWIGWVGRNYVQFASQTDKPTEKE IIIDVPVALSFISTGYIWPFAAFKEFTSGNLIAKEDEITVSPR
Uniprot No.

Target Background

Function

This protein likely participates in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein contributes to the specific binding of plastocyanin to Photosystem I.

Protein Families
PsaF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Photosystem I reaction center subunit III (psaF) in photosynthetic systems?

PsaF serves as a regulatory checkpoint that promotes the assembly of Light-Harvesting Complex I (LHCI) in photosystem I (PSI). According to recent structural studies, PSI consists of at least 13 nuclear-encoded and 4 chloroplast-encoded subunits that together function as a sunlight-driven oxidoreductase . The absence of PsaF results in a PSI assembly intermediate that lacks at least eight subunits, including LHCI, and exhibits no photoreduction activity . This indicates that PsaF plays a crucial role in coupling biogenesis to function in photosynthetic systems.

Methodologically, researchers can investigate PsaF function through isolation of assembly intermediates from greening tissues, followed by structural characterization and activity assays to compare wild-type and PsaF-deficient photosystems.

What experimental approaches are most effective for studying interactions between recombinant psaF and other photosystem components?

Based on current research methodologies, several approaches are recommended for investigating psaF interactions:

  • Structural biology approaches: Cryo-electron microscopy of isolated PSI complexes with and without psaF can reveal the structural basis for interactions. The recent structural characterization of PSI assembly intermediates lacking psaF demonstrates the effectiveness of this approach .

  • Reconstitution experiments: Recombinant psaF can be incorporated into liposomes or nanodiscs along with other PSI components to study assembly processes in vitro. The availability of recombinant G. theta psaF expressed in E. coli facilitates such studies .

  • Proteomics analysis: Mass spectrometry-based approaches similar to those used for analyzing phycobiliprotein components in G. theta can identify interaction partners of psaF . For this methodology, researchers should:

    • Use crosslinking agents to capture transient interactions

    • Employ co-immunoprecipitation with psaF-specific antibodies

    • Analyze samples using LC-MS/MS with high sensitivity settings

  • Complementation studies: Introducing recombinant psaF into psaF-deficient systems can test functional restoration and identify critical regions for interaction through site-directed mutagenesis.

What are the optimal conditions for storage and reconstitution of recombinant G. theta psaF?

Based on established protocols for recombinant G. theta psaF, researchers should follow these guidelines for optimal protein stability and activity:

Storage conditions:

  • Long-term storage: -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

Reconstitution protocol:

  • Centrifuge the vial briefly before opening to collect the lyophilized powder

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation: 50%) for long-term storage

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

Research has shown that these conditions maintain protein stability while preserving the functional characteristics necessary for experimental applications.

How can researchers verify the structural integrity and functionality of recombinant psaF?

Multiple analytical approaches should be employed to ensure recombinant psaF quality:

  • SDS-PAGE analysis: This technique verifies protein purity (>90% is typically considered acceptable for functional studies)

  • Circular dichroism (CD) spectroscopy: Useful for confirming proper secondary structure formation

  • Binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to test interactions with known binding partners

  • Functional complementation: Introduction of recombinant psaF into psaF-deficient systems should restore photoreduction activity if the protein is properly folded

  • Mass spectrometry: Verification of exact mass and detection of any post-translational modifications

For researchers working with G. theta psaF, it's important to note that functional activity may require proper membrane environment or the presence of interaction partners, as psaF serves as a regulatory checkpoint for photosystem assembly .

How might understanding psaF function contribute to improving photosynthetic efficiency in biotechnology applications?

The role of psaF as a regulatory checkpoint in PSI assembly offers several promising research directions:

  • Engineered photosystems: Understanding how psaF regulates LHCI assembly could enable the design of optimized photosystems with enhanced light-harvesting capabilities. Since psaF absence results in non-functional photosystems lacking photoreduction activity , targeted modifications could potentially enhance assembly efficiency.

  • Synthetic biology applications: The psaF regulatory mechanism could be adapted to create synthetic switches for controlling photosynthetic apparatus assembly in engineered organisms.

  • Stress resistance: Investigations into how psaF function relates to photosystem stability under stress conditions could lead to more resilient photosynthetic organisms for biotechnology applications.

  • Comparative analysis across species: The G. theta psaF could be compared with counterparts from other photosynthetic organisms to identify adaptations that optimize function under different environmental conditions. This approach could uncover natural variations with superior properties for biotechnology applications.

What is the relationship between psaF and the unique light-harvesting mechanisms in cryptophyte algae like G. theta?

Cryptophyte algae like G. theta have evolved a novel soluble light-harvesting antenna utilizing phycobilin pigments to complement the membrane-intrinsic Chl a/c-binding LHC antenna . While direct evidence connecting psaF to this unique antenna system is limited, several research questions warrant investigation:

  • Does psaF in G. theta have specialized adaptations to facilitate energy transfer from the phycobiliprotein antenna to PSI?

  • How does the regulatory role of psaF in PSI assembly relate to the expression of phycobiliprotein components, which show light-dependent regulation patterns ?

  • Are there direct interactions between psaF and components of the phycobiliprotein antenna system?

Proteomic analysis has shown that G. theta expresses all 20 α-subunits of its phycobiliprotein antenna under white light, with expression levels varying based on light intensity . This suggests a complex regulatory network controlling light harvesting, which likely involves psaF in its role as a PSI assembly regulator.

Future research should employ co-expression analysis and interaction studies to elucidate the potential coordination between psaF expression/function and the unique phycobiliprotein antenna system of cryptophytes.

How conserved is psaF across different photosynthetic organisms, and what can this tell us about its function?

While the search results don't directly address psaF conservation, comparative genomic approaches would provide valuable insights into its evolution and function. Researchers investigating this question should:

  • Compare psaF sequences across diverse photosynthetic lineages, including cyanobacteria, algae, and land plants

  • Identify conserved residues that likely correspond to critical functional domains

  • Analyze co-evolution patterns with other photosystem components to identify functional relationships

  • Examine adaptation signatures in the psaF sequences of organisms with unusual photosynthetic mechanisms, such as the cryptophyte G. theta

This approach could reveal how psaF has been adapted to function with the diverse light-harvesting strategies found across photosynthetic organisms, including the unique phycobiliprotein antenna system of cryptophytes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.