Recombinant Guillardia theta Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

CP47 forms the inner antenna complex of PSII, directly interfacing with the reaction center (PsbA/PsbD heterodimer) . Key functions include:

  • Light Harvesting: Binds 14–16 chlorophyll molecules for energy transfer to the reaction center .

  • Structural Stabilization: Maintains PSII integrity by anchoring oxygen-evolving complex proteins .

  • Electron Transport: Facilitates plastoquinone oxidation via interactions with PsbH and PsbT subunits .

Mutations in psbB disrupt PSII assembly, impairing photosynthetic efficiency .

Recombinant Expression

  • Expression Host: E. coli BL21 (DE3) or similar strains .

  • Yield: Typically 0.1–1.0 mg/mL post-purification .

  • Storage Stability: Lyophilized powder retains activity for >6 months at -80°C .

Research Applications

  • PSII Assembly Studies: Used to investigate chlorophyll-protein interactions and photodamage repair mechanisms .

  • Biophysical Analyses: Enables spectroscopic characterization of energy transfer pathways .

  • Mutagenesis Platforms: Serves as a template for site-directed mutagenesis to probe functional residues .

Genomic and Evolutionary Context

Guillardia theta’s plastid genome retains high psbB conservation with red algae, reflecting shared ancestry . Notable features:

  • Introns: The psbB operon lacks mobile introns, unlike related cryptophytes (e.g., Chroomonas borealis) .

  • Copy Number: Each cell contains 130–260 plastid genome copies, ensuring robust psbB expression .

Limitations and Considerations

  • Thermal Sensitivity: Requires strict -80°C storage to prevent aggregation .

  • Reconstitution: Optimal activity requires glycerol (5–50%) and avoidance of freeze-thaw cycles .

  • Species-Specificity: Functional insights may not fully translate to plant CP47 homologs (e.g., Lactuca sativa) .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-509
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM YVMPFMARIGVTDSWGGWSITGESVSNPGFWSFEGVALAHIGLSGLLFLAAVWHWVYWDL ELFRDPRTGNPALDLPKIFGIHLVLAGLLCFGFGAFHVTGAWGPGIWVSDAYGITGKVQP VAPTWGPEGFNPFNPSGVASHHIAAGILGFIAGIFHIAVRPPQRLYRALRMGNIETVLSS SIAAVFFAAFITTGTMWYGSATTPIELFGPTRYQWDSGYFQQEIERRVENSLNEGLSLSE AWSRIPDKLAFYDYVGNNPAKGGLFRAGPMNKGDGIAEAWLGHPVFQDKEGRELTVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSVEQVGVTVSFYGGKLNGQTYTDAPTVKKY ARKAQLGEVLEFDRTTLESDGVFRSSPRGWYTFGHANFALLFFLGHLWHGSRTLFRDVFS GIGAEVTEQVEFGAFQKLGDRSTKKQGAV
Uniprot No.

Target Background

Function
CP47, also known as Photosystem II CP47 chlorophyll apoprotein (psbB), is a crucial component of the core complex within photosystem II (PSII). It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical processes of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of CP47 protein in photosynthetic organisms?

CP47 serves as the core antenna protein of Photosystem II and is indispensable for the assembly of a functional photosystem II complex. This chlorophyll-binding protein facilitates light harvesting and energy transfer to the reaction center. Studies have demonstrated that CP47 contains multiple histidine residues positioned in hydrophobic regions that likely function as chlorophyll binding sites . The protein plays a critical role in both structural organization and energy transfer within the photosystem II complex, with accumulation of both chlorophyll and the CP47 protein being essential prerequisites for proper photosystem II assembly .

How conserved is the psbB gene sequence across different photosynthetic species?

Research comparing the psbB gene from different species indicates significant conservation across evolutionary distance. Sequence analysis of the psbB gene from Synechocystis 6803 (cyanobacterium) and spinach revealed 68% homology at the DNA level and 76% homology at the amino acid level . This conservation extends to the protein's hydropathy patterns, which are nearly indistinguishable between these diverse species, suggesting that the general membrane folding structure of CP47 has been highly preserved throughout evolution. This conservation highlights the functional importance of CP47's specific structural characteristics in photosynthetic organisms across different kingdoms.

What are the key structural features of CP47 protein that contribute to its function?

CP47 protein contains several critical structural features essential for its function:

  • Five pairs of histidine residues spaced by 13-14 amino acids located in hydrophobic regions that likely serve as chlorophyll binding sites

  • A specific membrane topology with multiple transmembrane domains

  • A distinct hydropathy pattern that dictates its folding in the thylakoid membrane

  • Regions that interact with other photosystem II components

What are the recommended protocols for cloning and expressing the psbB gene from Guillardia theta?

When cloning and expressing the psbB gene from Guillardia theta, researchers should follow these methodological steps:

  • Gene Isolation: Extract total DNA from Guillardia theta cultures in logarithmic growth phase. The psbB gene can be amplified using PCR with primers designed based on conserved regions of the gene identified through sequence alignment with other cryptophyte psbB sequences.

  • Vector Selection: Choose an expression vector compatible with the host system (typically E. coli for initial cloning, followed by cyanobacterial or algal expression systems for functional studies).

  • Transformation Protocol:

    • For E. coli: Standard heat-shock or electroporation methods

    • For cyanobacterial hosts: Natural transformation or electroporation

    • For eukaryotic algae: Electroporation or biolistic methods

  • Expression Verification: Western blotting using antibodies against conserved regions of CP47 or epitope tags if incorporated into the recombinant construct.

  • Biosafety Considerations: All recombinant DNA work must comply with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, including appropriate Institutional Biosafety Committee approval .

Remember that expression of functional CP47 requires the presence of chlorophyll biosynthesis pathways in the host organism, as the availability of chlorophyll directly impacts CP47 accumulation .

How can researchers assess the proper folding and integration of recombinant CP47 into thylakoid membranes?

Assessment of proper CP47 folding and membrane integration requires multiple complementary approaches:

  • Membrane Fractionation: Isolate thylakoid membranes through differential centrifugation and confirm CP47 localization using Western blotting.

  • Protease Protection Assays: Treat isolated membranes with proteases with/without membrane disruption to determine protein topology.

  • Spectroscopic Analysis:

    • Circular dichroism to assess secondary structure

    • Chlorophyll fluorescence to evaluate pigment binding

    • Absorption spectroscopy at specific wavelengths (465nm for Chl c, 680nm for Chl a)

  • Blue Native PAGE: To assess incorporation of CP47 into higher-order complexes.

  • Functional Assays:

    • Oxygen evolution measurements

    • Variable chlorophyll fluorescence (Fv/Fm ratio)

    • P680+ reduction kinetics

A properly folded and integrated CP47 protein should demonstrate characteristic spectroscopic properties, protection from protease digestion in intact membranes, and association with other photosystem II components in native gel electrophoresis.

What host systems are most effective for expressing functional recombinant CP47 protein?

The effectiveness of expression systems for recombinant CP47 varies based on research objectives:

Host SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, easy genetic manipulationLacks chlorophyll, improper membrane insertionStructural studies of protein segments, antibody production
Cyanobacteria (Synechocystis 6803)Native-like environment, chlorophyll synthesis, photosynthetic machinerySlower growth, more complex transformationFunctional studies, complementation assays, mutagenesis analysis
Chlamydomonas reinhardtiiEukaryotic processing, thylakoid structure similar to higher plantsComplex transformation, lower yieldsStudies requiring eukaryotic post-translational modifications
Guillardia thetaNative environment for the proteinDifficult transformation, limited genetic toolsStudies of species-specific interactions

For functional studies, photosynthetic organisms (particularly cyanobacteria) offer significant advantages as they provide the chlorophyll necessary for proper CP47 accumulation. Research has demonstrated that chlorophyll availability directly impacts the synthesis and stability of CP47 protein , suggesting that hosts with active chlorophyll biosynthesis pathways are essential for producing functional recombinant protein.

What are the key amino acid residues critical for chlorophyll binding in CP47, and how can they be identified experimentally?

Critical chlorophyll-binding residues in CP47 can be identified through both computational and experimental approaches:

  • Sequence Analysis: Five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions have been identified as potential chlorophyll binding sites in CP47 . These conserved histidines are prime candidates for site-directed mutagenesis.

  • Site-Directed Mutagenesis Approach:

    • Target conserved histidine residues individually

    • Create alanine substitutions to eliminate binding potential

    • Analyze mutants for changes in spectroscopic properties

    • Quantify chlorophyll binding capacity

  • Spectroscopic Verification:

    • Absorption spectroscopy (changes at 465nm for Chl c and 680nm for Chl a)

    • Circular dichroism to detect structural changes

    • Fluorescence emission spectra to track energy transfer efficiency

  • Functional Consequences:

    • Measure photosystem II activity in mutants

    • Analyze electron transport rates

    • Assess oxygen evolution capacity

Experimental evidence indicates that mutation of these key residues typically results in reduced chlorophyll binding, altered spectroscopic properties, and impaired photosystem II assembly and function, confirming their critical role in CP47's antenna function.

How do mutations in the psbB gene affect photosystem II assembly and function in vivo?

Mutations in the psbB gene have profound effects on photosystem II as demonstrated in research with CP47 mutants:

  • Complete Disruption Effects: Interruption of the psbB gene with a kanamycin resistance cassette results in complete loss of photosystem II activity, confirming that intact CP47 is absolutely required for a functional photosystem II complex .

  • Point Mutation Effects:

    • Mutations affecting chlorophyll binding sites typically reduce photosystem II assembly efficiency

    • Mutations in regions interacting with other PSII subunits can destabilize the entire complex

    • Some mutations allow assembly but impair energy transfer efficiency

  • Compensatory Mechanisms: Studies of CP47 mutants have revealed that some defects can be partially overcome through increased chlorophyll availability. Research with Synechocystis CP47 mutants demonstrated that:

    • Spontaneous pseudorevertants with decreased ferrochelatase activity showed improved photoautotrophic growth

    • Inhibition of ferrochelatase activity in vivo restored photoautotrophic growth in CP47 mutants

    • Supplementation with chlorophyll precursors (Mg-protoporphyrin IX) increased the number of active photosystem II centers in CP47 mutants

These findings indicate that mutations in psbB primarily affect photosystem II by disrupting either chlorophyll binding, protein-protein interactions within the complex, or both. The severity of the phenotype depends on the specific location and nature of the mutation.

What techniques can be used to study the interaction between CP47 and other components of the photosystem II complex?

The interaction between CP47 and other photosystem II components can be studied using multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CP47 to pull down associated proteins, followed by mass spectrometry identification.

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry to identify proximities between specific residues of different proteins.

  • Yeast Two-Hybrid or Split-GFP Assays: For mapping specific interaction domains between CP47 and other proteins.

  • Blue Native PAGE: To visualize intact complexes and subcomplexes containing CP47.

  • Cryo-Electron Microscopy: For structural determination of the entire photosystem II complex at high resolution.

  • Förster Resonance Energy Transfer (FRET): To measure distances between fluorescently labeled components.

  • Surface Plasmon Resonance: For quantitative measurement of binding affinities between isolated components.

  • Genetic Approaches:

    • Second-site suppressor screening to identify compensatory mutations

    • Deletion analysis to map functional domains

By combining these approaches, researchers can develop detailed interaction maps showing how CP47 is positioned within the photosystem II complex and how it communicates with other components to facilitate energy transfer and photosynthetic function.

How does the structure and function of CP47 from Guillardia theta compare to those from other photosynthetic organisms?

Guillardia theta, as a cryptophyte alga, represents an interesting evolutionary position for comparative studies of CP47. While specific comparative data for G. theta CP47 is limited in the provided search results, broader comparisons can be inferred:

  • Sequence Conservation: The high sequence homology (76% at amino acid level) observed between cyanobacterial and plant CP47 suggests that G. theta CP47 likely preserves key functional regions, particularly the chlorophyll-binding histidine residues .

  • Spectroscopic Properties: G. theta contains both chlorophyll a and c (with absorption peaks at 680nm and 465nm respectively) , suggesting its CP47 must accommodate different chlorophyll types compared to organisms with only chlorophyll a.

  • Antenna System Integration: Unlike cyanobacteria and higher plants, G. theta possesses phycobiliproteins (with absorption at 545nm for phycoerythrin) as additional light-harvesting components. This suggests potential unique interactions between CP47 and the cryptophyte light-harvesting system.

  • Regulatory Mechanisms: G. theta can perform state transitions triggered specifically by blue light absorbed by the membrane-integrated chlorophyll a/c antennae, but not by green light absorbed by lumenal biliproteins . This suggests species-specific regulatory mechanisms affecting CP47 function.

These differences reflect the unique evolutionary history of cryptophytes and their photosynthetic apparatus, making G. theta CP47 valuable for understanding the diversity and evolution of photosystem II components across different evolutionary lineages.

What role does CP47 play in state transitions in Guillardia theta compared to other photosynthetic organisms?

State transitions represent a regulatory mechanism that optimizes excitation energy distribution between photosystems. In Guillardia theta, this process shows distinctive characteristics:

  • Triggering Mechanism: Unlike in green algae and plants where state transitions are typically regulated by the redox state of the plastoquinone pool, in G. theta they are specifically triggered by blue light absorbed by the membrane-integrated chlorophyll a/c antennae, while green light absorbed by lumenal biliproteins is ineffective .

  • Proposed Mechanism: State transitions in G. theta are proposed to involve small rearrangements of intrinsic antennae proteins (including CP47), resulting in their coupling/uncoupling to photosystems in state 1 or state 2, respectively .

  • Physiological Context: G. theta performs state transitions primarily during logarithmic growth phase, while cells in stationary phase switch to non-photochemical quenching as their primary photoprotective mechanism .

  • Comparative Significance: G. theta represents a chromalveolate algae capable of performing state transitions, providing evidence that this regulatory mechanism evolved independently in multiple photosynthetic lineages .

The role of CP47 in this process is likely related to its position at the interface between the core reaction center and peripheral antenna systems, potentially serving as a key component in the reorganization of light-harvesting complexes during state transitions.

What regulatory and biosafety considerations apply to research involving recombinant psbB gene expression?

Research involving recombinant psbB gene expression must adhere to specific regulatory guidelines:

  • NIH Guidelines Applicability: All recombinant or synthetic nucleic acid research conducted in the United States or with NIH funding must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules .

  • Institutional Oversight Requirements:

    • Institutional Biosafety Committee (IBC) approval is required before initiation of experiments

    • Risk assessment must be performed based on the characteristics of the recombinant materials

    • Containment levels must be determined based on risk group classification

  • Containment Considerations:

    • Most psbB recombinant work would typically fall under Biosafety Level 1 (BL1) as non-pathogenic

    • Large-scale cultures (>10 liters) require additional containment measures as specified in Appendix K of the NIH Guidelines

    • Work in non-traditional research organisms may require specific case-by-case assessment

  • International Research Considerations:

    • Research abroad must comply with host country rules if established

    • If no host country rules exist, research must be approved by an NIH-approved IBC and accepted by appropriate national governmental authority

    • Safety practices employed abroad must be reasonably consistent with NIH Guidelines

Researchers should consult with their institutional biosafety officers to ensure full compliance with current regulations before initiating any recombinant DNA work involving the psbB gene.

How can researchers troubleshoot low expression or misfolding issues when working with recombinant CP47?

Troubleshooting recombinant CP47 expression and folding issues requires systematic analysis:

  • Chlorophyll Availability Assessment:

    • Measure chlorophyll levels in expression system

    • Consider supplementation with chlorophyll precursors

    • Investigate potential inhibition of ferrochelatase to increase chlorophyll precursor availability

  • Expression System Optimization:

    • Verify codon optimization for host system

    • Test different promoters for appropriate expression levels

    • Consider chlorophyll-producing hosts if not already using them

    • Optimize growth conditions (light intensity, temperature, media composition)

  • Protein Stabilization Strategies:

    • Co-express chaperones specific to membrane proteins

    • Include stabilizing detergents during membrane extraction

    • Consider fusion tags that may enhance stability

  • Folding Assessment Methods:

    • Analyze protein by circular dichroism to assess secondary structure

    • Use limited proteolysis to identify misfolded regions

    • Apply fluorescence-based assays to test chlorophyll binding

  • Mutation Analysis Options:

    • Create chimeric proteins with segments from successfully expressed homologs

    • Identify and modify aggregation-prone regions

    • Consider introduction of stabilizing mutations

The critical insight from research is that CP47 accumulation is directly linked to chlorophyll availability , suggesting that strategies focusing on increasing chlorophyll biosynthesis or availability may be particularly effective in improving recombinant CP47 expression and proper folding.

What are the most promising advanced techniques for studying energy transfer dynamics in recombinant CP47-containing photosystems?

Advanced techniques for studying energy transfer dynamics in CP47-containing photosystems include:

  • Ultra-fast Spectroscopy:

    • Femtosecond transient absorption spectroscopy to track excitation energy movement

    • Time-resolved fluorescence spectroscopy with picosecond resolution

    • Two-dimensional electronic spectroscopy to map energy coupling between chromophores

  • Single-Molecule Techniques:

    • Single-molecule fluorescence spectroscopy to eliminate ensemble averaging

    • Fluorescence correlation spectroscopy to detect conformational dynamics

    • Single-particle cryo-EM for structural insights

  • Advanced Microscopy:

    • Super-resolution fluorescence microscopy to visualize photosystem organization

    • Near-field scanning optical microscopy for nanoscale resolution

    • Fluorescence lifetime imaging microscopy (FLIM) to map energy transfer efficiencies

  • Computational Approaches:

    • Quantum mechanical calculations of excitation energy transfer

    • Molecular dynamics simulations of pigment-protein interactions

    • Machine learning analysis of spectroscopic data

  • Genetic Engineering Strategies:

    • Site-specific incorporation of artificial fluorophores using unnatural amino acid technology

    • Creation of minimal CP47-reaction center complexes to simplify analysis

    • Development of optogenetic tools to manipulate energy transfer pathways

These approaches, particularly when used in combination, can provide unprecedented insights into the mechanisms of light energy capture, transfer, and conversion within photosystem II, with CP47 serving as a critical component in this energy transfer network.

How might the study of CP47 from Guillardia theta contribute to our understanding of photosynthetic evolution in eukaryotes?

Guillardia theta represents a valuable model for understanding photosynthetic evolution due to its position as a cryptophyte alga with a complex evolutionary history:

  • Secondary Endosymbiosis Insights: As cryptophytes acquired their plastids through secondary endosymbiosis, studying G. theta CP47 can help unravel how proteins adapted during this evolutionary process.

  • Chimeric Light-Harvesting Systems: G. theta possesses both membrane-integrated chlorophyll a/c antennae and lumenal phycobiliproteins , creating a unique mixed system. Examining how CP47 interacts with these different antenna types can reveal evolutionary adaptations.

  • State Transition Mechanisms: The capability of G. theta to perform state transitions, unlike many other chromalveolate algae, suggests independent evolution of this regulatory mechanism . Understanding CP47's role provides insight into convergent evolution of photosynthetic regulation.

  • Ecological Adaptation Signatures: Comparative analysis of CP47 sequence and function between G. theta and other photosynthetic organisms can identify adaptive changes related to different light environments.

The study of G. theta CP47 therefore offers a unique window into the evolution of photosynthesis across multiple endosymbiotic events and can help resolve phylogenetic relationships among diverse photosynthetic eukaryotes.

What emerging technologies might enhance our ability to manipulate and study the psbB gene and CP47 protein?

Several emerging technologies show promise for advancing research on psbB and CP47:

  • CRISPR-Cas9 Genome Editing:

    • Precise modification of the psbB gene in its native genomic context

    • Creation of conditional knockouts for essential genes

    • Development of tagged versions for in vivo tracking

    • High-throughput mutagenesis for structure-function analysis

  • Synthetic Biology Approaches:

    • De novo design of simplified CP47 variants

    • Creation of minimal photosystems for focused mechanistic studies

    • Development of hybrid photosystems with enhanced properties

  • Advanced Imaging Technologies:

    • Cryo-electron tomography for in situ structural studies

    • Single-molecule tracking in living cells

    • Label-free imaging techniques for non-invasive analysis

  • Artificial Intelligence Applications:

    • Improved protein structure prediction

    • Machine learning analysis of spectroscopic data

    • Automated design of protein variants with specific properties

  • Nanoscale Tools:

    • Nanoscale sensors for measuring local environmental changes around CP47

    • Single-cell manipulations for heterogeneity analysis

    • Nanopore sequencing for rapid mutant screening

These technologies, particularly when used in combination, promise to revolutionize our understanding of CP47 structure, function, and evolution by providing unprecedented resolution in both spatial and temporal dimensions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.