Recombinant Guillardia theta Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

As the D1 subunit of PSII, this protein:

  1. Maintains charge separation during water oxidation

  2. Provides binding pockets for:

    • Chlorophyll a (6 molecules)

    • β-carotene (2 molecules)

    • Plastoquinone Q_B

  3. Coordinates with rubredoxin (RBD1) for PSII assembly - mutants lacking RBD1 homologs show 70% reduced PSII activity in Synechocystis sp. PCC 6803 and Arabidopsis thaliana

Critical mutations in the Q_B site (e.g., S264A) disrupt proton-coupled electron transfer, abolishing oxygen evolution capacity .

Research Applications

This recombinant protein is commercially available (1,698.00 €/50 µg) for:

  • ELISA studies: Quantifying PSII damage under high-light stress

  • In vitro assembly assays: Testing Psb28 chaperone interactions

  • Site-directed mutagenesis: Investigating Q_B site protonation mechanisms

Key limitations include instability above 4°C and irreversible aggregation after >3 freeze-thaw cycles .

Evolutionary Significance

Phylogenetic analysis shows:

  • Rubredoxin-RBD1 co-evolved with PSII in oxygenic phototrophs

  • The Guillardia theta D1 protein clusters with cryptophyte sequences rather than cyanobacteria, suggesting horizontal gene transfer from red algal endosymbionts

  • Conserved Grotthuss proton wires (S264-H252-Q241) are maintained across 1.5 billion years of evolution

This protein's structural resilience explains its preserved function despite extensive sequence divergence in loop regions exposed to oxidative damage .

Current Research Frontiers

  1. Engineering thermostable variants via DE loop substitutions (e.g., P230G mutation increases half-life at 35°C by 40%)

  2. Cryo-EM studies revealing real-time Q_B plastoquinone exchange dynamics (2.1 Å resolution)

  3. Synthetic biology applications for biohydrogen production using modified PSII complexes

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format in the order notes, and we will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on your purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our protein products is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is defined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATTVFIIAFIAAPPVDI DGIREPVAGSLLYGNNIITGAVIPSSASIGIHFYPIWEAASLDEWLYNGGPYQLIVDHFL LGVCGWIGREWEFSYRLGMRPWISVAFTAPVAAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGLWPVVGIWFTALGIMTMAFNLNGF NFNQSVVDSQGRVINTWADILNRANLGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O. This process generates O(2) and a proton gradient, which is subsequently used for ATP formation. PSII consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Guillardia theta Photosystem Q(B) protein and what is its role in photosynthesis?

    The Photosystem Q(B) protein (also known as D1 protein or the product of the psbA gene) is a critical component of Photosystem II in cryptophyte algae like Guillardia theta. This 32 kDa thylakoid membrane protein functions in electron transport, with the primary role of binding the secondary quinone (QB) and facilitating electron transfer from the primary quinone (QA) . The full amino acid sequence of Guillardia theta Photosystem Q(B) protein consists of 344 amino acids, with key domains involved in quinone binding and electron transfer pathways . The protein is essential for efficient photosynthesis, specifically in water oxidation and the transfer of electrons through the photosynthetic electron transport chain.

  • How does the Guillardia theta Photosystem Q(B) protein compare structurally to homologous proteins in other organisms?

    Although specific crystal structures of Guillardia theta Photosystem Q(B) protein aren't detailed in the provided materials, comparative analysis indicates high conservation in functional domains. The protein shares structural similarities with D1 proteins in other photosynthetic organisms, particularly in the quinone binding pocket regions, which is critical for proper electron transfer . Research on quinone redox potentials in Photosystem II demonstrated conserved H-bond patterns for QB sites among bacterial photosynthetic reaction centers and PSII, indicating evolutionary conservation of functional domains . The membrane-integrated structure allows for optimal positioning within the thylakoid membrane to facilitate electron transport between the primary quinone (QA) and secondary quinone (QB).

  • What expression systems are most effective for producing recombinant Guillardia theta Photosystem Q(B) protein?

    Based on available research data, E. coli expression systems have been successfully employed for producing recombinant Guillardia theta photosystem proteins. For instance, the related Photosystem II D2 protein (psbD) has been expressed in E. coli with N-terminal His tags, which facilitates purification . When expressing membrane proteins like Photosystem Q(B), specialized protocols are necessary to address challenges related to proper folding and solubility. The most effective approaches typically involve:

    • Using expression vectors with inducible promoters optimized for membrane protein expression

    • Culturing at lower temperatures (16-25°C) after induction to slow expression rate

    • Including appropriate detergents during cell lysis and purification steps

    • Employing affinity tags (predominantly His-tags) to facilitate purification

    Storage in stabilizing buffers containing glycerol (typically 50%) is recommended to maintain protein integrity during freeze-thaw cycles .

Advanced Research Questions

  • What are the quinone redox potentials in Guillardia theta Photosystem II and how do they compare with other photosynthetic organisms?

    The redox potentials of quinones in Photosystem II are critical determinants of electron transfer efficiency. While Guillardia theta-specific measurements aren't provided in the search results, research on PSII has revealed important principles applicable across photosynthetic organisms:

    • The redox potential (Em) of plastoquinone for one-electron reduction is significantly influenced by the protein environment

    • Two distinct H-bond patterns involving QA and surrounding amino acids (like D2-Thr217) can result in approximately 100 mV upshift in Em(QA) when the H-bond is present

    • At the QB site, H-bond formation between QB and specific amino acids (like D1-Ser264) depends on the protonation state of nearby residues (such as D1-His252)

    • These H-bond patterns are highly conserved across bacterial photosynthetic reaction centers and PSII in various organisms, indicating their essential role in electron transfer function

    For precise determination of quinone redox potentials in Guillardia theta specifically, researchers should consider employing electrochemical methods combined with spectroscopic techniques to analyze the native protein or properly folded recombinant versions.

  • How can site-directed mutagenesis of the Photosystem Q(B) protein be used to study electron transport mechanisms?

    Site-directed mutagenesis provides powerful insights into electron transport mechanisms by allowing the systematic modification of key residues. While specific G. theta studies weren't detailed in the search results, research on D1 protein mutants in other photosynthetic organisms demonstrates the approach:

    • Substitutions at critical positions (e.g., A250R and S264K in Chlamydomonas) can significantly impair QA reoxidation, evidenced by changes in chlorophyll fluorescence parameters

    • Such mutations can reduce electron transfer efficiency between QA and QB by up to 50% compared to wild-type

    • Photosynthetic oxygen evolution capacity is correspondingly affected, with some mutants showing only 40% of wild-type activity

    • Key residues to target include:

      • Those involved in quinone binding pocket formation

      • Amino acids participating in hydrogen bonding networks

      • Residues that influence the redox properties of electron carriers

    Experimental design should include:

    1. Generation of specific point mutations at conserved residues

    2. Expression and reconstitution of mutant proteins

    3. Comprehensive characterization via biophysical techniques

    4. Measurement of electron transfer kinetics and efficiency using multiple complementary approaches

  • What role does the Photosystem Q(B) protein play in photoprotection mechanisms within Guillardia theta?

    The Photosystem Q(B) protein (D1) serves a dual role in both photosynthesis and photoprotection in Guillardia theta. Research indicates several photoprotection-related functions:

    • The formation of hydrogen bonds between the Q(B) protein and surrounding amino acids may function as a photoprotection mechanism, particularly in high light conditions

    • In G. theta, photoprotective non-photochemical quenching (NPQ) is observed primarily in stationary phase cultures, suggesting developmental regulation of these mechanisms

    • The characteristics of NPQ in Guillardia theta differ from those in related cryptophytes like Rhodomonas salina, indicating species-specific adaptations

    • During high light stress, the D1 protein (Photosystem Q(B) protein) is often the primary target of photodamage and undergoes rapid turnover as part of the PSII repair cycle

    Research on D1 protein mutants in other organisms has revealed that specific amino acid substitutions can significantly alter pigment accumulation patterns during high light/high temperature stress, particularly affecting xanthophyll cycle components like antheraxanthin and zeaxanthin . This suggests that the Q(B) protein may influence broader metabolic responses to stress beyond its direct electron transport role.

  • What analytical techniques are most appropriate for studying the interaction between recombinant Photosystem Q(B) protein and other components of the photosynthetic apparatus?

    Multiple complementary analytical techniques are necessary to comprehensively study protein-protein and protein-cofactor interactions:

    1. Proteomics approaches:

      • Mass spectrometry-based identification of interaction partners

      • Crosslinking mass spectrometry (XL-MS) to identify specific interaction sites

      • Identification confidence can be assessed using parameters such as expectation values (<0.05 corresponding to >95% confidence)

    2. Biophysical techniques:

      • Förster Resonance Energy Transfer (FRET) to measure distances between components

      • Surface Plasmon Resonance (SPR) to quantify binding affinities and kinetics

      • Isothermal Titration Calorimetry (ITC) for thermodynamic characterization of interactions

    3. Structural biology methods:

      • Cryo-electron microscopy for visualizing protein complexes

      • X-ray crystallography for atomic-level interaction details

      • Small-angle X-ray scattering (SAXS) for solution-state structural information

    4. Functional assays:

      • Electron transfer measurements in reconstituted systems

      • Fluorescence-based assays to monitor energy transfer between components

      • Oxygen evolution measurements to assess functional consequences of interactions

    When studying recombinant proteins, it's essential to verify that they maintain native-like interactions, potentially through comparison with data from intact thylakoid membranes or membrane preparations from G. theta.

  • How do phylogenetic analyses inform our understanding of Guillardia theta Photosystem Q(B) protein evolution?

    Phylogenetic analyses of photosystem components provide crucial evolutionary context:

    • Chloroplast genome sequencing indicates that all chloroplasts, including those in Guillardia theta, originated from a single primary endosymbiotic event involving the capture of a cyanobacterium

    • While the chloroplasts of glaucocystophytes, red algae, and green algae are thought to be direct products of this primary endosymbiosis, cryptophyte chloroplasts (including G. theta) are believed to have originated from secondary endosymbiosis

    • Analysis of chloroplast genome structure and gene content reveals that G. theta has undergone gene loss compared to more gene-rich chloroplast genomes like that of Porphyra

    • The photosystem components of cryptophytes represent unique evolutionary adaptations, with proteins like the Photosystem Q(B) protein showing both conservation of core functional domains and lineage-specific modifications

    Researchers should consider:

    1. Conducting comparative analyses of Photosystem Q(B) protein sequences across diverse photosynthetic organisms

    2. Examining rates of evolutionary change in different protein domains to identify conserved vs. rapidly evolving regions

    3. Correlating sequence changes with functional adaptations to different ecological niches

  • What are the challenges and solutions for maintaining stability of recombinant Guillardia theta Photosystem Q(B) protein during in vitro experiments?

    Membrane proteins like Photosystem Q(B) present significant stability challenges for in vitro work:

    Key Challenges:

    • Proper folding in heterologous expression systems

    • Maintaining native structure during purification

    • Preventing aggregation in solution

    • Preserving function during storage and experimental procedures

    Recommended Solutions:

    1. Buffer optimization:

      • Use Tris-based buffers with appropriate pH (typically pH 8.0)

      • Include stabilizing agents like glycerol (6-50%)

      • For longer-term storage, consider adding trehalose (6%) for cryoprotection

    2. Storage protocols:

      • Aliquot protein solutions to avoid repeated freeze-thaw cycles

      • Store working aliquots at 4°C for up to one week

      • Maintain long-term stocks at -20°C or -80°C

    3. Reconstitution strategies:

      • Reconstitute lyophilized protein in deionized sterile water

      • Aim for concentrations of 0.1-1.0 mg/mL

      • Consider adding 5-50% glycerol to the final solution

    4. Experimental considerations:

      • Use mild detergents to maintain membrane protein structure

      • Include appropriate cofactors (pigments, lipids) to stabilize native conformation

      • Consider incorporating the protein into nanodiscs or liposomes for functional studies

    These approaches will help maintain the structural integrity and functional properties of the recombinant protein during experimental manipulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.