Recombinant Guillardia theta Uncharacterized tatC-like protein ycf43 (ycf43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type requirements, please inform us. We will prioritize development of the specified tag.
Synonyms
ycf43; Uncharacterized tatC-like protein ycf43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Guillardia theta (Cryptomonas phi)
Target Names
ycf43
Target Protein Sequence
MLFNLTVLVMKTFKFHYKFILLFSNKFRFYLYYYMKTRSNSVLIPYTLNFKQVEAEMSLA EHLEEIRQRAFWSFSVLTTMIISCIIFVKNIVKTLQEPAAGIKFLQFAPGEYFFASIKVA AYSGILISSPFIVYQILLFVLPGMTKDERKTLLPIIIGSMILFLLGLIFGYYILVPASLN FFIKYGSDVVEPFWSFEQYFEFILVLLFGTALAFQLPVLQLVLGFLRIVSGKTMFSIWRY VILLSTVVGAVLTPSVDPLTQILLSSIILILYFGGASLVLVVEGSQKNNN
Uniprot No.

Target Background

Protein Families
TatC family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Guillardia theta uncharacterized tatC-like protein ycf43?

The Guillardia theta uncharacterized tatC-like protein ycf43 is a full-length protein consisting of 290 amino acids with a sequence starting with mLFNLTVLVMKTFKFHYKFILLFSNKFRFYLYYYMKTRSNSVLIPYTLNFKQVEAEMSLA and continuing through to the C-terminal sequence ending with SSIILILYFGGASLVLVVEGSQKNNN. This protein has been assigned the UniProt accession number O78493, indicating its recognition in standard protein databases. The protein sequence suggests membrane-spanning regions typical of tatC-like proteins, which are often involved in twin-arginine translocation pathways in various organisms.

The tatC-like designation suggests structural similarities to components of the twin-arginine translocation (Tat) pathway, which is responsible for transporting folded proteins across membranes in various organisms. This structural classification provides important context for understanding potential functional roles, particularly in the unique endosymbiotic environment within Guillardia theta cells.

How does the evolutionary context of Guillardia theta inform our understanding of ycf43?

Guillardia theta acquired photosynthetic capabilities through secondary endosymbiosis, a process where it engulfed and retained a photosynthetic eukaryote (likely a red alga based on phylogenetic evidence). This evolutionary history has resulted in a unique cellular organization where a small volume of endosymbiont cytoplasm persists alongside a residual nucleus called the nucleomorph. The nucleomorph genome has been severely reduced and now encodes only a few hundred genes, including the ycf43 gene.

The retention of specific genes like ycf43 in the highly reduced nucleomorph genome suggests these proteins serve essential functions that could not be lost during reductive evolution or transferred to the host nucleus. Understanding this evolutionary context helps researchers interpret why certain proteins have been maintained despite massive genomic reduction, potentially indicating their critical roles in endosymbiont-host integration or plastid function.

What purification methods are most effective for recombinant Guillardia theta ycf43?

For effective purification of recombinant Guillardia theta ycf43, a combined approach utilizing affinity chromatography followed by size exclusion chromatography has demonstrated optimal results. The protein should be expressed with an appropriate tag (typically determined during the production process) to facilitate initial capture. When using heterologous expression systems like Pichia pastoris (as demonstrated with similar Guillardia theta proteins), inclusion of detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations of 0.05-0.1% throughout purification helps maintain protein stability.

During purification, maintaining the protein in a Tris-based buffer with 50% glycerol optimizes stability and prevents aggregation. It is crucial to avoid repeated freeze-thaw cycles, as these can significantly reduce protein activity and structural integrity. For long-term storage, maintaining purified ycf43 at -20°C or -80°C in single-use aliquots preserves functionality, while working aliquots should be kept at 4°C and used within one week.

How might the ycf43 protein function in the context of Guillardia theta's complex endosymbiotic organization?

The ycf43 protein likely plays a critical role in the unique cell biology of Guillardia theta, particularly in mediating interactions between the nucleomorph-derived structures and the plastid. Given its tatC-like classification, ycf43 may function in protein translocation processes that maintain the highly specialized compartmentalization within this organism. This function would be particularly significant considering that Guillardia theta represents an evolutionary intermediate in endosymbiotic integration, where the endosymbiont's cellular structures persist but in highly reduced forms.

The nucleomorph genome of Guillardia theta has retained genes encoding various structural and functional proteins despite extreme reduction, suggesting these elements remain essential for cellular function. Similar to how tubulin genes remain in the nucleomorph despite the apparent absence of microtubules in the endosymbiont, ycf43 may represent a component of a reduced but still necessary cellular machinery that facilitates crucial processes in the periplastidal compartment. Research approaches that examine protein-protein interactions between ycf43 and other nucleomorph-encoded or plastid-encoded proteins could reveal integration mechanisms that have evolved through the endosymbiotic relationship.

What methodological challenges exist in studying the function of ycf43, and how might they be overcome?

Investigating the function of ycf43 presents several significant methodological challenges. First, the protein's classification as "uncharacterized" indicates limited knowledge of its precise biochemical activities. Second, its location within the complex cellular organization of Guillardia theta creates difficulties in isolating native protein in sufficient quantities for functional studies. Third, the potential membrane association of tatC-like proteins often results in solubility issues during recombinant expression.

To overcome these challenges, researchers might employ a multi-faceted approach:

Methodological ChallengePotential SolutionExpected Outcome
Limited native protein availabilityHeterologous expression systems optimized for membrane proteins, such as Pichia pastoris with inducible promotersProduction of sufficient protein quantities for biochemical characterization
Unknown binding partnersCo-immunoprecipitation followed by mass spectrometryIdentification of protein interaction networks
Ambiguous subcellular localizationFluorescent protein tagging combined with super-resolution microscopyPrecise determination of ycf43's location within the cell's complex architecture
Functional characterizationComplementation studies in model organisms with defects in related protein translocation systemsInsights into functional capabilities of ycf43

Similar approaches have proven successful with other Guillardia theta proteins such as anion channelrhodopsins, where recombinant expression followed by spectroscopic and functional characterization revealed unexpected nitrate transport preferences.

How does the evolutionary retention of ycf43 in the nucleomorph genome compare to other retained genes?

The retention of ycf43 in the nucleomorph genome of Guillardia theta represents an intriguing example of selective gene preservation during reductive evolution. Comparative analysis with other retained nucleomorph genes reveals patterns that may inform our understanding of endosymbiotic integration. Like the previously characterized tubulin genes (alpha, beta, and gamma) in the nucleomorph, ycf43 may represent components of cellular machinery that remain essential despite drastic reduction in the endosymbiont's complexity.

Phylogenetic analysis of nucleomorph-encoded proteins supports the origin of the cryptomonad nucleomorph from a red alga. This evolutionary context suggests that ycf43 may have specific functions related to red algal biology that necessitated its retention. Unlike most chloroplast-related genes that were either lost or transferred to the host nucleus during endosymbiotic integration, the ycf43 gene has remained within the nucleomorph genome, suggesting potential challenges in relocating its genetic information or requirements for local expression within the periplastidal compartment.

What expression systems are most suitable for producing functional recombinant Guillardia theta ycf43?

For optimal expression of functional recombinant Guillardia theta ycf43, several expression systems warrant consideration based on success with similar proteins from this organism. Pichia pastoris has proven particularly effective for expressing membrane-associated Guillardia theta proteins, as demonstrated with the full-length anion channelrhodopsin (GtACR1_full). When using this system, maintaining proper post-translational modifications requires careful optimization of growth conditions, including nitrogen source availability, which has been shown to influence expression levels of related proteins in their native context.

Expression vectors should incorporate appropriate tags to facilitate purification while minimizing interference with protein folding. For membrane-associated proteins like ycf43, fusion constructs with fluorescent proteins can enable simultaneous tracking of expression and localization. Temperature modulation during expression (typically lowering to 20-25°C) often improves proper folding of recombinant Guillardia theta proteins. The resulting protein can be stored in a Tris-based buffer with 50% glycerol to maintain stability, but researchers should be aware that repeated freeze-thaw cycles significantly reduce activity.

What analytical techniques are most informative for characterizing the structure-function relationship of ycf43?

Complementary approaches include:

  • Circular dichroism spectroscopy to assess secondary structure composition and thermal stability

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries and flexible regions

  • Site-directed mutagenesis of conserved residues followed by functional assays to establish structure-function correlations

  • Molecular dynamics simulations based on homology models to predict conformational changes and interaction surfaces

For functional characterization, researchers might adapt methodologies used with other Guillardia theta membrane proteins, such as the pH measurements in cell suspensions employed to assess anion transport activity of GtACR1. This indirect approach could reveal ion specificity and transport kinetics if ycf43 participates in similar processes.

How can comparative genomics inform the functional characterization of ycf43?

Comparative genomics provides a powerful framework for gaining functional insights into the uncharacterized ycf43 protein. By analyzing the conservation patterns of ycf43 across cryptomonads and related organisms, researchers can identify evolutionarily conserved domains that likely correspond to essential functional regions. Special attention should be given to comparing ycf43 with homologs in free-living red algae, the presumed evolutionary ancestors of the cryptomonad endosymbiont.

The genomic context of ycf43 within the nucleomorph genome may provide additional functional clues. Co-expression analysis of nucleomorph genes under various conditions could reveal functional relationships, similar to how nitrogen depletion was found to enhance expression of certain Guillardia theta genes. Furthermore, the presence of ycf43 in the nucleomorph rather than in the host nuclear genome suggests potential constraints on gene transfer or expression requirements that are informative about the protein's function.

The following analytical workflow has proven effective for similar uncharacterized proteins:

  • Identify homologs across diverse taxa using PSI-BLAST and HMM-based approaches

  • Perform multiple sequence alignment to identify conserved motifs

  • Conduct co-evolution analysis to predict functionally coupled residues

  • Map conservation patterns onto structural models to identify surface-exposed conserved regions

  • Analyze genomic context across species to identify consistently co-occurring genes

What controls are essential when designing experiments to study ycf43 function?

When designing experiments to study ycf43 function, several critical controls must be implemented to ensure valid and interpretable results. First, researchers should include both positive and negative controls for expression systems. A well-characterized membrane protein from Guillardia theta, such as the anion channelrhodopsin GtACR1, can serve as a positive control for expression, purification, and functional assays. As a negative control, a mutated version of ycf43 with alterations to predicted functional residues should be included to confirm specificity of observed effects.

For localization studies, researchers must control for potential artifacts introduced by protein tags or overexpression. This includes confirming that tagged proteins maintain their native function and comparing multiple tagging strategies (N-terminal versus C-terminal) to identify potential interference with trafficking or function. Control experiments should also address the complex compartmentalization in Guillardia theta by using markers for different cellular compartments (plastid, nucleomorph, periplastidal space) to enable precise localization.

When investigating potential roles in protein translocation, researchers should include controls with established substrates of the Tat pathway alongside predicted substrates of ycf43. Additionally, experiments should be conducted under varying environmental conditions, particularly those known to affect endosymbiont-host relationships in cryptomonads, such as nitrogen availability, which has been shown to influence the expression of other nucleomorph-encoded genes.

How can researchers address data inconsistencies in ycf43 functional studies?

Addressing data inconsistencies in ycf43 functional studies requires systematic investigation of potential sources of variability. One common source of inconsistency is protein preparation methods, as recombinant ycf43 may exhibit different properties depending on expression systems, purification protocols, and storage conditions. Researchers should standardize these variables and directly compare protein preparations using analytical techniques like size exclusion chromatography and dynamic light scattering to ensure consistent protein quality.

Another potential source of inconsistency is the complex cellular organization of Guillardia theta. When studying ycf43 in its native context, researchers must account for the influence of other cellular compartments and processes. This can be addressed through techniques that provide spatial and temporal resolution, such as:

  • Sample fractionation to isolate specific cellular compartments before analysis

  • Time-course experiments to capture dynamic processes

  • Single-cell analysis to account for cellular heterogeneity

  • Simultaneous monitoring of multiple cellular parameters

When inconsistencies persist despite these approaches, researchers should consider whether they reflect biologically meaningful variability rather than technical artifacts. For example, the protein may exhibit different functional properties depending on post-translational modifications or interaction partners, as observed with the cytoplasmic domain of GtACR1 which influences ion selectivity.

What ethical considerations should researchers address when working with recombinant Guillardia theta proteins?

While research on recombinant Guillardia theta proteins generally presents minimal ethical concerns compared to studies involving sentient organisms, researchers should still address several important ethical considerations. First, as with all recombinant DNA research, proper biosafety practices must be followed to prevent unintended environmental release of genetically modified organisms, particularly when using expression systems like Pichia pastoris that could potentially survive outside laboratory conditions.

Second, researchers should carefully consider the environmental impact of collecting wild Guillardia theta samples if needed for comparative studies. Although microalgae are abundant, collection methods should minimize ecosystem disruption, particularly in sensitive marine environments. When possible, established culture collections should be utilized as the source of original genetic material.

Third, there are broader research integrity considerations, including transparent reporting of experimental conditions and results, particularly negative or inconsistent findings that might inform future research directions. This includes detailed documentation of protein preparation methods, storage conditions, and batch-to-batch variability that could affect experimental outcomes. Additionally, researchers should acknowledge the limits of model systems and exercise caution when extrapolating findings to natural environments or other organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.