Recombinant Guinea pig 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (EBP)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

EBP facilitates isomerization by:

  1. Protonation: His76 donates a proton to Δ8-sterol at C9α, generating a carbocation at C8 .

  2. Stabilization: Trp196 forms a π-cation interaction with the carbocation intermediate .

  3. Deprotonation: Glu80 abstracts a proton from C7β, regenerating His76’s activity .

Interaction with Smoothened (SMO)

EBP modulates Hedgehog (Hh) signaling by:

  • Inhibiting SMO Cholesterylation: Overexpression of EBP reduces cholesterol attachment to SMO’s D95, suppressing Hh pathway activity .

  • C-Terminal Dependency: The C-terminal domain of EBP is critical for SMO binding and regulatory function .

Drug Binding and Resistance

EBP binds cationic amphiphiles (e.g., emopamil, ifenprodil) with high affinity, contributing to multidrug resistance .

CompoundBinding Affinity (pKi)TargetSource
Ifenprodil19.8 nM (pKi)Guinea pig EBP[3H]emopamil displacement
(+/-)-Emopamil10.2 nM (pKi)Guinea pig liver membranes
TamoxifenStructural mimic of sterol intermediatesHuman EBP crystal complex

Cholesterol Biosynthesis

  • Pathway Analysis: Recombinant EBP is used to study lanosterol-to-cholesterol conversion, particularly in zymosterol metabolism .

  • Disease Models: Mutations in EBP cause Conradi-Hunermann syndrome (CDPX2), characterized by skeletal dysplasia and skin defects .

Drug Discovery

  • High-Throughput Screening: EBP’s promiscuous binding cavity makes it a model for testing small-molecule interactions .

  • Anticancer Research: Inhibition of EBP disrupts autophagy in tumor cells, enhancing therapeutic efficacy .

Recombinant Protein Details

ParameterValueSource
Sequence Length229 amino acids
Amino Acid SequenceIncludes conserved Glu residues and aromatic-rich transmembrane domains
Tag InformationN-terminal 10xHis-tag
Purity>95% (SDS-PAGE)

Functional Assays

  • Enzymatic Activity: Assayed via Δ8→Δ7 isomerization of zymosterol .

  • SMO Interaction: Co-immunoprecipitation and cholesterylation assays validate EBP’s regulatory role in Hh signaling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
EBP; 3-beta-hydroxysteroid-Delta(8,Delta(7-isomerase; Cholestenol Delta-isomerase; Delta(8-Delta(7 sterol isomerase; D8-D7 sterol isomerase; Emopamil-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-229
Protein Length
Full Length of Mature Protein
Species
Cavia porcellus (Guinea pig)
Target Names
EBP
Target Protein Sequence
ATTSTGPLHPYWPRHLRLDHFVPNDLSAWYIVTVLFTVFGALVVTMWLLSSRASVVPLGT WRRLSVCWFAVCAFVHLVIEGWFVLYQKAILGDQAFLSQLWKEYAKGDSRYIIEDNFIIC MESITVVLWGPLSLWAVIAFLRQHPSRYVLQFVISLGQIYGDLLYFLTEYRDGFQHGEMG HPIYFWFYFFFMNVLWLVIPGVLFFDSVKQFYGAQNALDTKVMKSKGK
Uniprot No.

Target Background

Function
Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.
Database Links
Protein Families
EBP family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope. Cytoplasmic vesicle.
Tissue Specificity
Highly expressed in liver, bowel, adrenal gland, testis, ovary, and uterus and less expressed in brain, cerebellum, skeletal muscle, and heart.

Q&A

What is the biological function of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) in guinea pigs?

Unlike some other steroidogenic enzymes that show tissue-specific expression patterns, EBP is expressed across multiple guinea pig tissues, with particularly notable presence in the endoplasmic reticulum of liver and kidney cells . This wide distribution reflects its fundamental importance in maintaining steroid metabolism across various physiological systems.

How does guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase compare structurally and functionally to the human ortholog?

The guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase shares considerable structural homology with its human counterpart, particularly in the catalytic domains. The human enzyme (230 amino acids, 26.3 kDa) contains four transmembrane regions (positions 29-49, 66-86, 121-141, and 185-205) . Comparative sequence analysis reveals that while the guinea pig enzyme maintains the core functional domains, there are species-specific variations that may influence substrate specificity and catalytic efficiency.

Key structural features conserved between species include:

  • Four transmembrane domains anchoring the protein to the endoplasmic reticulum

  • The EBP domain (Pfam: PF05241) containing the catalytic machinery

  • Specific binding regions for sterol substrates

Functional assays demonstrate that despite evolutionary divergence, both enzymes catalyze essentially the same reaction in the cholesterol biosynthetic pathway, suggesting strong evolutionary conservation of this critical metabolic function .

What are the optimal expression systems for producing recombinant guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Based on established protocols for related recombinant guinea pig proteins, the preferred expression system for producing functional guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase is Escherichia coli. Successful expression typically employs the following methodology:

  • Cloning the mature coding region into a vector containing an N-terminal His-tag (e.g., pQE30-based vectors)

  • Expression in E. coli strain M15 or BL21(DE3)

  • Induction with IPTG (typically 0.5-1.0 mM) for 4-5 hours at 30°C

  • Harvesting and lysing cells under appropriate buffer conditions

The expressed protein often forms inclusion bodies in the insoluble fraction (as observed with related guinea pig proteins like IFN-γ) . Therefore, purification typically requires:

  • Solubilization using denaturants (6-8M urea or guanidinium hydrochloride)

  • Affinity purification via nickel-NTA chromatography

  • Controlled renaturation through gradual dialysis against decreasing concentrations of denaturant

This strategy has successfully yielded biologically active recombinant guinea pig proteins of approximately 18 kDa (comparable to EBP's expected size), with correct folding confirmed by functional assays .

What methods are most effective for assessing the activity of recombinant guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Multiple complementary approaches are recommended for comprehensive assessment of recombinant guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase activity:

Enzyme Kinetics Analysis:

  • Substrate conversion assays using Delta(8)-sterols

  • Determination of apparent Km values (typically in the nanomolar range for steroid substrates)

  • Measurement of Vmax (reported values for related enzymes range from 30-50 pmol/min per mg protein)

Structural Validation:

  • N-terminal amino acid sequencing to confirm identity

  • SDS-PAGE analysis (expected molecular weight ~18 kDa)

  • Western blotting using polyclonal antibodies raised against the recombinant protein

Competitive Inhibition Studies:

  • Using known inhibitors of sterol isomerases

  • Determining Ki values for competitive inhibitors (e.g., pregnenolone has shown Ki values around 5 μM for related enzymes)

A complete characterization should involve multiple parameters, as enzymatic activity can be significantly affected by buffer composition, pH, temperature, and the presence of potential inhibitors or activators .

What is the significance of guinea pig models in studying 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in human disease contexts?

Guinea pigs offer distinct advantages as models for studying 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in relation to human diseases for several key reasons:

  • Steroid Metabolism Similarities: Guinea pigs demonstrate steroid hormone profiles more similar to humans than mice or rats, particularly regarding the presence and ratios of specific sterols in circulation .

  • Embryonic Development Relevance: Recent studies identify guinea pigs as valuable models for human preimplantation development, with close resemblance in timing of developmental stages and expression of key regulatory genes . This provides opportunities to study EBP's role in early development.

  • Immunological Compatibility: Guinea pigs show immune responses to steroid-related signaling pathways that more closely mirror human responses, making them useful for studying inflammatory and immune aspects of steroid metabolism disorders .

  • Translational Research Potential: The guinea pig has emerged as a promising small animal model that bridges the gap between mouse models and non-human primates, offering a practical system for translational research involving steroid metabolism enzymes .

Studies employing guinea pig models have successfully recapitulated aspects of human steroid-related disorders and provided insights into therapeutic approaches that could not be observed in mice models alone .

How do sex differences influence the expression and activity of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in guinea pigs?

Significant sex differences have been documented in the expression and activity of 3-beta-hydroxysteroid isomerase dehydrogenase enzymes in guinea pigs. Research demonstrates:

  • Expression Level Differences:

    • Female guinea pigs exhibit approximately one-third the level of enzyme activity in kidney tissue compared to males

    • Similar sex disparities exist in liver tissue, with lower expression in females

  • Hormonal Regulation:

    • The observed sex differences suggest partial androgen control of enzyme expression

    • This regulatory mechanism appears to be tissue-specific, with reproductive and non-reproductive tissues showing different patterns of response to sex hormones

  • Physiological Implications:

    • These differences contribute to sex-specific patterns of steroid metabolism

    • Female guinea pigs show different patterns of 21-hydroxypregnenolone utilization

    • The differential expression affects downstream steroid hormone production in a sex-dependent manner

This sexual dimorphism has important implications for experimental design, as results may vary significantly between male and female animals. Researchers should carefully consider and document the sex of guinea pigs used in studies involving 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase to ensure reproducibility and accurate interpretation of results .

What role does 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase play in guinea pig embryonic development?

3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase plays crucial roles in guinea pig embryonic development through its involvement in sterol metabolism. Recent research has revealed:

  • Preimplantation Development: Guinea pigs serve as an excellent model for human preimplantation development, showing similar timing of compaction, blastocyst formation, and implantation processes . During these critical developmental windows, EBP contributes to sterol homeostasis necessary for membrane formation and signaling.

  • Lineage Specification: EBP is involved in sterol metabolism that influences cell fate decisions. Studies show that in guinea pig embryos, the Hippo signaling pathway (which can be modulated by sterol metabolites) is implicated in trophectoderm versus epiblast differentiation, similar to humans .

  • Developmental Signaling: The enzyme affects sterol composition that modulates key developmental pathways:

    • JAK-STAT signaling (involved in primitive endoderm specification)

    • PI3K-Akt pathway components (including INSR and IGF1, differentially regulated in epiblast)

  • Long-term Developmental Impact: Perturbations in sterol metabolism during early embryonic stages can influence the developmental trajectories of various tissues and organs, potentially affecting long-term health outcomes .

The guinea pig model has revealed that proper sterol metabolism during preimplantation development provides the foundation for subsequent embryonic development, with implications for assisted reproductive technologies and understanding the impacts of early developmental exposures .

What are the methodological challenges in purifying recombinant guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Purification of recombinant guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase presents several technical challenges that researchers must address:

  • Protein Solubility Issues:

    • The enzyme typically forms inclusion bodies in bacterial expression systems

    • Related guinea pig recombinant proteins have been identified as 18-kDa bands in the insoluble fraction

    • This necessitates purification under denaturing conditions followed by renaturation

  • Refolding Complexity:

    • Proper refolding is critical for maintaining enzymatic activity

    • Controlled dialysis is typically required to remove denaturants gradually

    • Success in refolding similar guinea pig recombinant proteins has been achieved through stepwise dialysis protocols

  • Activity Preservation:

    • Transmembrane domains may not fold properly in recombinant systems

    • EBP contains four transmembrane regions that are critical for its localization and function

    • Buffer optimization is necessary to maintain enzyme stability and activity

  • Verification Challenges:

    • N-terminal amino acid sequencing is essential to confirm protein identity

    • Western blotting with specific antibodies should be employed

    • Functional assays must be carefully designed to confirm proper folding and activity

Based on experience with similar guinea pig proteins, a successful purification strategy typically involves:

  • Purification using Ni affinity chromatography under denaturing conditions

  • Renaturation through controlled dialysis

  • Confirmation of proper folding through both structural analyses and functional assays

How can cytokine signaling influence 3-beta-hydroxysteroid isomerase expression in guinea pig tissues?

Cytokine signaling has been demonstrated to significantly modulate the expression of 3-beta-hydroxysteroid isomerase enzymes in guinea pig tissues through several distinct mechanisms:

  • Interleukin-4 (IL-4) and IL-13 Signaling:

    • These cytokines potently induce 3-beta-HSD type 1 expression in multiple cell types

    • The induction involves rapid elevation of 3-beta-HSD mRNA levels as confirmed by Northern blot and RT-PCR analyses

    • This effect has been observed across various cell types including epithelial cells

  • STAT6 Activation Pathway:

    • The stimulatory effect of IL-4 is consistently associated with activation of Signal Transducer and Activator of Transcription 6 (STAT6)

    • STAT6 acts as the principal transcription factor mediating IL-4 effects on 3-beta-HSD expression

    • Cell types that respond to IL-4 with increased enzyme expression show STAT6 DNA-binding activity after 30-minute exposure

  • Cell-Type Specificity:

    • While some cell types show strong induction, others fail to respond to cytokine stimulation

    • This heterogeneity indicates tissue-specific regulatory mechanisms at play

    • The presence of STAT6 activation correlates with responsiveness to IL-4/IL-13

  • Functional Consequences:

    • Cytokine induction of 3-beta-HSD may contribute to local steroid biosynthesis from adrenal precursors

    • This mechanism could significantly impact steroid hormone levels in peripheral tissues

    • The induction pattern suggests cytokines may regulate steroidogenesis in infection or inflammation contexts

These findings highlight the complex interplay between immune system signaling and steroid metabolism in guinea pig tissues, with potential implications for understanding similar mechanisms in humans .

What are the current methods for detecting and quantifying 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in guinea pig tissue samples?

Multiple complementary techniques are currently employed for reliable detection and quantification of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in guinea pig tissue samples:

Protein Detection Methods:

  • Western Blotting:

    • Using polyclonal antibodies raised against purified recombinant protein

    • Expected molecular weight of approximately 45 kDa

    • Can detect differential expression between tissue types

  • Immunohistochemistry:

    • Allows visualization of tissue distribution patterns

    • Particularly useful for comparing expression across different zones of tissues

    • Enables correlation with histological features

  • ELISA-Based Quantification:

    • Commercial recombinant guinea pig EBP ELISA kits are available

    • Allows precise quantification of protein levels in tissue homogenates

Gene Expression Analysis:

  • RT-PCR:

    • Sensitive method for detecting mRNA expression

    • Can be used for comparing relative expression levels across tissues

    • Useful for studying transcriptional regulation

  • Northern Blot Analysis:

    • Enables detection of transcript size and abundance

    • Particularly valuable for identifying alternative transcripts

    • Has been successfully applied to 3-beta-HSD studies in guinea pigs

Functional Assays:

  • Enzyme Activity Measurement:

    • Conversion of Delta(8)-sterols to Delta(7)-isomers

    • Typically measured by chromatographic separation and quantification of metabolites

    • Allows determination of kinetic parameters (Km, Vmax)

  • Competitive Inhibition Assays:

    • Using known inhibitors (e.g., pregnenolone as a competitive inhibitor)

    • Can distinguish between different isozymes based on inhibition profiles

For comprehensive characterization, researchers typically employ multiple detection methods in parallel to confirm both the presence and functional activity of the enzyme in guinea pig tissues .

How do enzyme kinetics of guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase compare to related steroidogenic enzymes?

Guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase demonstrates distinctive kinetic properties compared to related steroidogenic enzymes, with important implications for experimental design and data interpretation:

Kinetic Parameters:

  • Substrate Affinity:

    • For related guinea pig 3-beta-hydroxysteroid enzymes, the apparent Km for 21-hydroxypregnenolone is approximately 85 nM

    • This relatively high affinity suggests specialized roles in steroid metabolism

  • Catalytic Efficiency:

    • Vmax values of around 33 pmol/min per mg protein have been reported for related guinea pig 3-beta-hydroxysteroid enzymes

    • These rates reflect the physiological constraints on steroid conversion capacity

  • Inhibition Profiles:

    • Pregnenolone acts as a competitive inhibitor with Ki values in the low micromolar range (approximately 5 μM)

    • This competitive inhibition provides insight into substrate binding mechanisms

Comparative Analysis:

EnzymeSubstrateKm (nM)Vmax (pmol/min/mg)InhibitorKi (μM)
Guinea pig 3β-HSD21-hydroxypregnenolone8533Pregnenolone5
Human 3β-HSD type 1DHEA300-70040-60--
Human EBPΔ8-sterols400-50025-30--

Tissue-Specific Variations:

  • Activity in female guinea pig kidney is approximately one-third that of males

  • Similar sex differences are observed in liver tissue

  • These variations suggest hormonal regulation of enzyme expression and activity

The distinct kinetic properties of guinea pig 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase make it particularly suitable for studying specific aspects of sterol metabolism that may be relevant to human physiological and pathological conditions .

What genetic factors influence the expression and activity of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in guinea pig populations?

The expression and activity of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in guinea pig populations are influenced by multiple genetic factors with important implications for research using these models:

Genetic Variation Factors:

  • Strain Differences:

    • Outbred Hartley guinea pigs show greater heterogeneity in enzyme expression compared to inbred strains

    • Inbred strains (such as strain 13) display more consistent expression patterns but are less readily available and more difficult to maintain

    • These strain differences can significantly impact experimental outcomes and reproducibility

  • Sex-Linked Expression Patterns:

    • Sex differences in enzyme activity suggest X or Y chromosome-linked regulatory elements

    • Male guinea pigs consistently show higher enzyme levels in kidney and liver tissues

    • This sexual dimorphism likely reflects evolutionarily conserved reproductive adaptations

  • Genetic Adaptation Considerations:

    • Laboratory-adapted guinea pig strains may show different enzyme expression profiles compared to wild populations

    • This adaptation process can alter the regulation of steroidogenic enzymes

    • Guinea pigs originated from the Andean region of South America, and domestication has influenced their genetic makeup

Research Implications:

  • Experimental Design Considerations:

    • Researchers should carefully select guinea pig strains based on experimental needs

    • Documenting strain characteristics is essential for reproducibility

    • Inbreeding effects should be considered when interpreting results

  • Translational Relevance:

    • Understanding genetic variation in enzyme expression helps assess the translational value of findings

    • Comparison with human genetic variation provides context for interpreting results

    • The genetic diversity of outbred guinea pigs may better model human population heterogeneity in some contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.