Recombinant Guinea pig 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characterization

The guinea pig HTR1B receptor is a G-protein coupled receptor (GPCR) comprising 390 amino acids, sharing 77% transmembrane sequence identity with the human 5-HT1B receptor . Key features include:

PropertyDetails
GeneHTR1B (LOC100717602 in guinea pigs)
Expression SystemRat C6-glial cells, E. coli, mammalian cells
Binding Affinity (pKd)9.62–9.85 for [³H]-5-CT and [³H]-GR 125743
Signaling PathwayInhibits adenylate cyclase via Gαi/o proteins; modulates neurotransmitter release

Functional assays using agonist-stimulated [³⁵S]-GTPγS binding demonstrate that recombinant HTR1B couples efficiently to G-proteins, with agonists like 5-HT, sumatriptan, and zolmitriptan showing high efficacy (E<sub>max</sub>: 0.76–0.85 vs. 5-HT) . Inverse agonists such as SB224289 and methiothepin suppress basal activity, confirming constitutive receptor signaling .

Pharmacological Profile

The receptor exhibits distinct ligand-binding properties:

Agonists and Antagonists

CompoundActivityPotency (pEC₅₀/pA₂)Key Role
5-HTFull agonist8.2–9.4Endogenous ligand; activates G-proteins
SumatriptanPartial agonist7.8–8.0Migraine therapy target
SB224289Inverse agonist8.73 (pA₂)Blocks constitutive activity
MethiothepinCompetitive antagonist9.74 (pA₂)Reverses agonist effects

Ligand-binding studies reveal strong correlations (r²: 0.72–0.88) between guinea pig and human 5-HT1B receptors, though species-specific differences exist (e.g., ketanserin shows weaker antagonism in guinea pigs) .

Research Applications

Recombinant HTR1B is widely used to:

  1. Study Migraine Mechanisms: Evaluate triptans (e.g., sumatriptan dimer) for cerebral vasoconstriction and anti-migraine efficacy .

  2. Characterize Inverse Agonism: Investigate SB224289 and ritanserin in modulating basal receptor activity .

  3. Compare Species Variants: Assess pharmacological differences between guinea pig, rat, and human 5-HT1B receptors .

Key Research Findings

  • G-Protein Coupling Efficiency: Guinea pig HTR1B shows lower efficacy in G-protein activation compared to rat receptors in the substantia nigra, suggesting species-specific signaling dynamics .

  • Structural Insights: The receptor’s extracellular loop 2 and transmembrane domain 7 are critical for ligand selectivity, particularly for ergot alkaloids .

  • Therapeutic Relevance: Dimerization of sumatriptan enhances 5-HT1B/1D receptor binding affinity, highlighting strategies to improve migraine therapeutics .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
Full length protein
Species
Cavia porcellus (Guinea pig)
Target Names
Target Protein Sequence
MGNPEASCTPPAVLGSQTGLPHANVSAPPNNCSAPSHIYQDSIALPWKVLLVVLLALITL ATTLSNAFVIATVYRTRKLHTPANYLIASLAFTDLLVSILVMPISTMYTVTGRWTLGQAL CDFWLSSDITCCTASIMHLCVIALDRYWAITDAVGYSAKRTPRRAAGMIALVWVFSICIS LPPFFWRQAKAEEEVLDCLVNTDHVLYTVYSTGGAFYLPTLLLIALYGRIYVEARSRILK QTPNKTGKRLTRAQLITDSPGSTSSVTSINSRAPEVPCDSGSPVYVNQVKVRVSDALLEK KKLMAARERKATKTLGVILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFTWLGYLN SLINPIIYTMSNEDFKQAFHKLIRFKCTT
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine (serotonin) receptor 1B (HTR1B) is a G-protein coupled receptor. It also functions as a receptor for various alkaloids and psychoactive substances. Ligand binding induces a conformational change, triggering signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. This signaling pathway inhibits adenylate cyclase activity. Arrestin family members suppress signaling via G proteins and mediate activation of alternative signaling pathways. HTR1B regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Moreover, it plays a role in vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HTR1B and what role does it play in the serotonergic system?

The 5-hydroxytryptamine receptor 1B (HTR1B) belongs to the serotonin receptor family, which includes over 20 subtypes classified based on their pharmacological and biochemical properties. HTR1B receptors are widely distributed in the basal ganglia, hippocampus, and other cortical regions. These receptors are located on both presynaptic and postsynaptic terminals and mediate the release of serotonin and non-serotonin neurotransmitters .

HTR1B is a G protein-coupled receptor that primarily couples to pertussis toxin-sensitive G proteins, typically resulting in the inhibition of adenylyl cyclase. This coupling mechanism appears to be universally expressed across various cell types and is extremely efficient even at low physiological receptor expression levels .

How do HTR1B knockout models inform our understanding of receptor function?

Genetic knockout studies have provided valuable insights into HTR1B function. Mice lacking the HTR1B receptor exhibit:

  • Increased impulsive aggression

  • Enhanced spatial memory performance

  • Increased exploratory activity

  • Higher preference for alcohol

  • Decreased anxiety behaviors

These behavioral phenotypes suggest HTR1B is involved in regulating mood, cognition, and reward pathways . Additionally, HTR1B knockout mice show profound changes in visual function despite normal retinal structure and retinal ganglion cell (RGC) counts. Specifically, these mice demonstrate:

  • 40% reduction in positive scotopic threshold response (pSTR) slope

  • 10-15% diminished scotopic contrast sensitivity thresholds

  • Reduced electroretinogram (ERG) amplitudes

These findings indicate HTR1B plays a previously unrecognized role in normal retinal physiology and visual function .

What are the challenges in identifying Guinea pig HTR1B compared to other species?

While HTR1B receptors have been well-characterized in humans and mice, specific identification of Guinea pig HTR1B presents unique challenges. Unlike the 5-HT1E receptor, which has been confirmed in Guinea pig brain tissue (particularly hippocampus) but is absent in rats and mice, specific information about Guinea pig HTR1B is more limited .

When attempting to identify and characterize Guinea pig HTR1B:

  • Consider using sequence homology approaches similar to those used to identify Guinea pig FcγRIV (protein H0VDZ8), which showed 55.3% identity and 72.5% similarity with human FcγRIIIA

  • Radioligand binding studies may require careful selection of masking agents to distinguish HTR1B from other 5-HT receptor subtypes

  • Be aware that pharmacological differences may exist between Guinea pig HTR1B and its human or mouse counterparts

What expression systems are most suitable for recombinant Guinea pig HTR1B studies?

When selecting an expression system for recombinant Guinea pig HTR1B, consider the following options based on successful approaches used for other recombinant 5-HT receptors:

Mammalian Cell Lines:

  • HEK293 cells provide efficient expression and are suitable for functional studies involving G-protein coupling and downstream signaling pathways

  • CHO cells offer stable expression and are useful for pharmacological characterization

  • LLC-PK1 polarized epithelial cells allow investigation of receptor distribution between apical and basolateral membranes

Other Expression Systems:

  • Xenopus oocytes have been successfully used for co-expression of 5-HT receptors with ion channels such as G protein-activated K+ channels (GIRK)

  • Baculovirus-infected insect cells can be used for large-scale receptor production

For best results, optimize codon usage for Guinea pig sequences, and consider using inducible expression systems to control receptor density on the cell surface.

How can the pharmacological profile of recombinant Guinea pig HTR1B be characterized?

Characterizing the pharmacological profile of recombinant Guinea pig HTR1B requires a systematic approach:

  • Radioligand Binding Assays:

    • Use [³H]5-HT as the primary radioligand (Kd expected to be in the low nanomolar range)

    • Employ selective antagonists to mask binding to other 5-HT receptor subtypes

    • Determine binding constants (Kd, Bmax) and competition binding profiles

  • Functional Assays:

    • Measure inhibition of forskolin-stimulated cAMP production

    • Assess G protein coupling using [³⁵S]GTPγS binding

    • Evaluate coupling to ion channels, particularly K+ channels

    • Monitor activation of MAPK/ERK pathways

  • Comparative Pharmacology:

    • Create a correlation plot of drug affinities between Guinea pig HTR1B and human HTR1B (similar to the approach used for 5-HT1E receptors, which showed an R² = 0.97 between cloned and native Guinea pig receptors)

What methods are effective for studying HTR1B expression patterns in Guinea pig tissues?

To investigate HTR1B expression patterns in Guinea pig tissues, several complementary techniques can be employed:

  • RNAscope in situ hybridization:

    • This technique has been successfully used to localize Htr1b mRNA in mouse retinal ganglion cell layer

    • Allows for high-sensitivity detection of mRNA expression in specific cell populations

    • Enables co-localization studies with other markers

  • Quantitative RT-PCR:

    • Provides quantitative assessment of HTR1B mRNA levels across different tissues

    • Requires careful primer design based on the Guinea pig HTR1B sequence

  • Immunohistochemistry/Immunofluorescence:

    • Dependent on availability of antibodies cross-reactive with Guinea pig HTR1B

    • May require validation using recombinant expression systems

  • Receptor Autoradiography:

    • Use selective radioligands with appropriate masking agents (similar to approaches used for 5-HT1E receptor identification in Guinea pig hippocampus)

    • Allows for anatomical mapping of receptor distribution

How do polymorphisms in the 3' region affect Guinea pig HTR1B expression and function?

Polymorphisms in the 3' region of the HTR1B gene can significantly impact receptor expression through post-transcriptional regulation. Studies of the human HTR1B 3' region identified several SNPs (including rs6297, rs3827804, rs140792648, rs9361234, rs76194807, rs58138557, and rs13212041) that affect reporter gene expression .

When investigating Guinea pig HTR1B polymorphisms:

  • Identify Guinea pig-specific polymorphisms:

    • Sequence the 3' region of the Guinea pig HTR1B gene from multiple animals

    • Compare with human polymorphic sites to identify conserved regions

  • Construct reporter gene assays:

    • Generate luciferase reporter constructs containing different haplotypes

    • Test the effect of truncated fragments to identify functional elements

    • Transfect into relevant cell lines (preferably of Guinea pig origin)

  • Investigate microRNA interactions:

    • Identify potential microRNA binding sites affected by polymorphisms

    • Validate interactions using reporter assays and microRNA mimics/inhibitors

  • Correlate with receptor expression:

    • Measure endogenous receptor levels in tissues with different genotypes

    • Assess functional differences using electrophysiological or signaling assays

What approaches can be used to study G protein coupling specificity of recombinant Guinea pig HTR1B?

Understanding G protein coupling specificity is crucial for characterizing recombinant Guinea pig HTR1B function:

  • BRET/FRET-based assays:

    • Generate fusion constructs of Guinea pig HTR1B and various G protein subunits

    • Measure real-time protein-protein interactions upon ligand stimulation

    • Compare coupling efficiency across different G protein subtypes

  • G protein-selective inhibitors:

    • Use pertussis toxin to block Gαi/o coupling

    • Employ selective inhibitors for other G protein families

    • Assess the impact on downstream signaling pathways

  • Chimeric G proteins:

    • Create chimeras between different G protein α subunits

    • Identify domains important for receptor coupling specificity

  • Receptor mutagenesis:

    • Target intracellular loops and C-terminal domain implicated in G protein coupling

    • Assess the effect of mutations on coupling efficiency to different G proteins

This approach parallels studies of 5-HT1A receptors, which have demonstrated coupling primarily to inhibition of adenylyl cyclase through pertussis toxin-sensitive G proteins, but with additional coupling to K+ channels in certain cellular contexts .

How can recombinant Guinea pig HTR1B be used to develop selective ligands for therapeutic applications?

Developing selective ligands for HTR1B has therapeutic potential for conditions including impulsivity disorders, aggressive behavior, and visual dysfunction. Recombinant Guinea pig HTR1B provides a valuable tool for this process:

  • High-throughput screening:

    • Establish stable cell lines expressing recombinant Guinea pig HTR1B

    • Develop reliable functional assays (calcium flux, cAMP, β-arrestin recruitment)

    • Screen compound libraries for agonist, antagonist, or allosteric modulator activity

  • Structure-activity relationship studies:

    • Compare binding affinities across species variants (Guinea pig, human, mouse)

    • Identify species-specific pharmacological differences

    • Use these differences to guide ligand optimization

  • In silico modeling:

    • Generate homology models of Guinea pig HTR1B based on crystal structures of related receptors

    • Perform virtual screening and docking studies

    • Predict ligand binding modes and key interaction residues

  • Validation in physiological systems:

    • Test candidate compounds in Guinea pig tissues expressing native HTR1B

    • Evaluate effects on visual function, given the role of HTR1B in retinal physiology

    • Compare with effects in HTR1B knockout models

What are the implications of HTR1B knockout studies for understanding potential therapeutic targets?

HTR1B knockout studies have revealed important phenotypes with therapeutic implications:

Visual Function Disorders:

  • Knockout mice show reduced ERG amplitudes and OKR thresholds despite normal retinal structure

  • This suggests HTR1B modulators might benefit patients with specific visual processing disorders

  • Testing in Guinea pig models could validate cross-species relevance

Behavioral Disorders:

  • Increased impulsive aggression in knockout mice suggests HTR1B agonists might reduce impulsivity

  • Enhanced spatial memory performance indicates potential cognitive effects of HTR1B modulation

  • Higher alcohol preference points to possible applications in addiction treatment

Methodology for Translational Studies:

  • Generate equivalent data in Guinea pig models using pharmacological HTR1B blockade

  • Compare with genetic knockout phenotypes in mice

  • Assess species differences in receptor distribution and signaling

  • Develop selective compounds optimized for Guinea pig HTR1B

  • Validate behavioral and physiological effects across species

How does Guinea pig HTR1B compare structurally and functionally to human and mouse orthologs?

Understanding cross-species differences is crucial for translational research:

Sequence Homology Approach:
Similar to the identification of Guinea pig FcγRIV, which showed 55.3% identity with human FcγRIIIA and 54.9% identity with mouse FcγRIV , a comprehensive sequence analysis of Guinea pig HTR1B should be performed comparing:

  • Transmembrane domains (highest conservation expected)

  • Ligand binding pocket residues

  • Intracellular loops involved in G protein coupling

  • N and C terminal regions (typically less conserved)

Functional Comparison:

  • Construct correlation plots of ligand binding affinities across species

  • Compare G protein coupling efficiency and selectivity

  • Assess downstream signaling pathway activation

  • Evaluate desensitization and internalization kinetics

Species-Specific Differences:

  • Be aware that species differences can significantly affect drug responses, as observed with Guinea pig FcγRIV which showed approximately 100-fold higher binding affinity for human IgG1 compared to human FcγRIIIA

  • These differences may impact translational research and drug development

What are common pitfalls in recombinant HTR1B expression and how can they be addressed?

Researchers working with recombinant Guinea pig HTR1B may encounter several technical challenges:

Low Expression Levels:

  • Optimize codon usage for the expression system

  • Use strong promoters (CMV, EF1α) for mammalian expression

  • Consider adding a signal peptide to enhance membrane targeting

  • Test multiple cell lines to identify optimal expression hosts

Receptor Misfolding:

  • Include chaperone proteins in expression systems

  • Express at lower temperatures (30-32°C) for mammalian cells

  • Add small molecule ligands during expression to stabilize receptor conformation

Constitutive Activity:

  • Characterize basal activity in multiple functional assays

  • Include inverse agonists as controls in functional studies

  • Consider using tetracycline-inducible systems to control expression levels

Receptor Desensitization:

  • Measure receptor internalization rates

  • Assess phosphorylation patterns

  • Study β-arrestin recruitment kinetics

  • Compare with human and mouse orthologs

How can functional differences between native and recombinant Guinea pig HTR1B be reconciled?

Functional differences between native and recombinant receptors represent a common challenge:

Methodological Approach:

  • Compare pharmacological profiles using identical assay conditions

  • Assess receptor density to account for reserve differences

  • Evaluate G protein expression levels in different systems

  • Consider the lipid environment and membrane composition

Specific Considerations:

  • The kinetic characteristics of G protein-regulated ion channels differ markedly between transfected cells and native tissues, as observed with 5-HT1A receptors

  • These differences may reflect variations in the cellular milieu, including differential expression of regulatory proteins

  • For Guinea pig HTR1B, comparing recombinant receptor properties with native receptors in tissues like the hippocampus would be valuable

Reconciliation Strategies:

  • Use native tissue preparations as benchmarks for validating recombinant systems

  • Consider reconstitution in artificial membrane systems with controlled composition

  • Employ proximity labeling techniques to identify interacting proteins in native versus recombinant systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.